BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D05 (646 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1778.02 |rap1||telomere binding protein Rap1|Schizosaccharom... 27 1.8 SPCC1682.03c |mug174||meiotically upregulated gene Mug174|Schizo... 27 3.1 >SPBC1778.02 |rap1||telomere binding protein Rap1|Schizosaccharomyces pombe|chr 2|||Manual Length = 693 Score = 27.5 bits (58), Expect = 1.8 Identities = 19/72 (26%), Positives = 34/72 (47%) Frame = +1 Query: 301 HVTCNQLLTDDISVAATCAKKIYKRHKFDAWYGWKNHCQHGLPDISDC*EKALNFIKQLL 480 HV N + V A+K Y +H ++W + + LP +SD E N+ ++++ Sbjct: 136 HVHKNDINRFGTKVYEELARK-YPQHSLESWRQHYKYMKKRLPPVSDSDES--NYCQRII 192 Query: 481 MKFTSSSCNLKQ 516 +K SS + Q Sbjct: 193 VKPYSSQKDYTQ 204 >SPCC1682.03c |mug174||meiotically upregulated gene Mug174|Schizosaccharomyces pombe|chr 3|||Manual Length = 626 Score = 26.6 bits (56), Expect = 3.1 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -1 Query: 646 IFVKIRKLWIIVPIKLW*EICQLFLDDFRFLNISIMHNIL 527 + +K+ +VPIK W QL L D L +++NI+ Sbjct: 1 MLLKVSSCEPLVPIKQWIHTSQLDLSDSSSLVADLLYNII 40 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,622,793 Number of Sequences: 5004 Number of extensions: 51351 Number of successful extensions: 121 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -