BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D05 (646 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0286 + 13915705-13915984,13916478-13917062,13918188-139186... 31 0.59 05_01_0149 + 989698-991797 31 0.78 11_01_0476 - 3672812-3672866,3673356-3673454,3685385-3686340 30 1.8 03_02_0583 + 9635002-9637299 29 3.2 05_03_0065 - 7953414-7953845,7953963-7954081,7954158-7955990,795... 28 7.3 08_02_0416 + 16902153-16902430,16903089-16903143,16903174-169032... 27 9.7 06_03_0830 + 25159758-25162460 27 9.7 >04_03_0286 + 13915705-13915984,13916478-13917062,13918188-13918661, 13918963-13920208,13920282-13920297 Length = 866 Score = 31.5 bits (68), Expect = 0.59 Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = +1 Query: 190 FTDKIGKVNKNGSRDYGLFQINDKYWCSTGSTPGKDCHVTC-NQLLTDDIS 339 FT ++N G D+ ++Q+ D+ +G+ P K C+VTC N+ +T+DI+ Sbjct: 124 FTLGYARLNITGC-DFDIYQVLDQ----SGNVPAKLCNVTCPNRGITEDIA 169 >05_01_0149 + 989698-991797 Length = 699 Score = 31.1 bits (67), Expect = 0.78 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 248 RSMTNTGAAPGPLLERIAT*LVISY*LTTLAWQL 349 RS TNTG P + R+ T +V + L T+ W+L Sbjct: 401 RSFTNTGRMPELFVMRLGTIMVTGFILATIFWRL 434 >11_01_0476 - 3672812-3672866,3673356-3673454,3685385-3686340 Length = 369 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = -2 Query: 318 LITSHVAILSRSG---PGAAPVFVIDLEEAVVSRSVLIHFTNFVGKPSAFVLDKADPVTH 148 ++ +A+L G G A + V+ E V+R+ + HF KP +++ D A PV+ Sbjct: 81 MVVVDLAVLEGHGLEEEGDAELLVLRSGEWTVTRAPVAHFVGRADKPPSWITDMAIPVSE 140 Query: 147 Q 145 + Sbjct: 141 R 141 >03_02_0583 + 9635002-9637299 Length = 765 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 248 RSMTNTGAAPGPLLERIAT*LVISY*LTTLAWQL 349 R+ TNT P L R+AT +V ++ L T+ W+L Sbjct: 466 RAFTNTRRTPELFLIRLATVVVTAFILATVFWRL 499 >05_03_0065 - 7953414-7953845,7953963-7954081,7954158-7955990, 7957103-7957559 Length = 946 Score = 27.9 bits (59), Expect = 7.3 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +1 Query: 202 IGKVNKNGSRDYG--LFQINDKYWCSTGSTPGKDCHVTCNQLLTDDISVAATCAKKIYKR 375 + V +G R G +F++ D+Y G HV Q++TD+ SV T A + + Sbjct: 447 LDSVECSGDRKDGKYIFELVDRYIEEIGEQ-----HVV--QVVTDNASVNTTAASLLTAK 499 Query: 376 HKFDAWYGWKNHC 414 W G+ HC Sbjct: 500 RPSIFWNGYAAHC 512 >08_02_0416 + 16902153-16902430,16903089-16903143,16903174-16903232, 16903565-16903655 Length = 160 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 418 VDSDFSIRTKRQTCGVCKSSLRT 350 V + ++ T+ QTCG K SLRT Sbjct: 82 VATPHTVETQHQTCGAVKQSLRT 104 >06_03_0830 + 25159758-25162460 Length = 900 Score = 27.5 bits (58), Expect = 9.7 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 1/80 (1%) Frame = +1 Query: 169 VENESGRFTDKIGKVNKNGSRDYGLFQINDKYWCSTGSTPGKDCHVTCNQLLTDDISVAA 348 + ++SG F+ K + K G D Q ++ C T ST + L+ I+VAA Sbjct: 482 ITDDSGTFSRKHTRSMKLGGIDLNENQCTEEVDCHTKSTLSNSIN------LSTPIAVAA 535 Query: 349 TCAKKIY-KRHKFDAWYGWK 405 + ++ R F+ GWK Sbjct: 536 SRTSSVFPARLHFEGELGWK 555 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,295,465 Number of Sequences: 37544 Number of extensions: 312326 Number of successful extensions: 698 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -