BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D03 (541 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19363| Best HMM Match : Neuromodulin (HMM E-Value=1.4) 29 1.8 SB_27357| Best HMM Match : MFMR (HMM E-Value=3.2) 29 2.4 SB_1509| Best HMM Match : SRR (HMM E-Value=0.22) 29 2.4 SB_14294| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_2329| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19) 27 7.4 SB_12515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_42896| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_29121| Best HMM Match : Toxin_12 (HMM E-Value=8.7) 27 9.8 >SB_19363| Best HMM Match : Neuromodulin (HMM E-Value=1.4) Length = 361 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +3 Query: 333 EIDKFLGDVDYSEATNPYISLSKTFS 410 ++D F GD+ +EA+NP+I+ K S Sbjct: 216 DMDSFTGDIPETEASNPFIAPQKVVS 241 >SB_27357| Best HMM Match : MFMR (HMM E-Value=3.2) Length = 468 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/51 (27%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Frame = +3 Query: 360 DYSEATNPYISLSKTFSEMNPDFFTMA-NKIYVGNKY-TLDEKFTSSSRQY 506 +YS + Y++LSK +S ++ ++ T++ N + Y TL + + + S+ Y Sbjct: 19 NYSTLSRNYLTLSKNYSTLSKNYLTLSKNYSTLSKNYLTLSKNYLTLSKNY 69 >SB_1509| Best HMM Match : SRR (HMM E-Value=0.22) Length = 644 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/51 (27%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Frame = +3 Query: 360 DYSEATNPYISLSKTFSEMNPDFFTMA-NKIYVGNKY-TLDEKFTSSSRQY 506 +YS + Y++LSK +S ++ ++ T++ N + Y TL + + + S+ Y Sbjct: 19 NYSTLSRNYLTLSKNYSTLSKNYLTLSKNYSTLSKNYLTLSKNYLTLSKNY 69 Score = 27.9 bits (59), Expect = 5.6 Identities = 13/49 (26%), Positives = 28/49 (57%) Frame = +3 Query: 360 DYSEATNPYISLSKTFSEMNPDFFTMANKIYVGNKYTLDEKFTSSSRQY 506 +YS + Y++LSK +S ++ ++ T++ N TL + + + S+ Y Sbjct: 112 NYSTLSKNYLTLSKNYSTLSKNYLTLSK-----NYSTLSKNYLTLSKNY 155 >SB_14294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 28.3 bits (60), Expect = 4.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 63 VFWLSTTRGRVNMIKLYLFAVIAVCNVRAF 152 + WL G+ + + +Y + V+A CN+ F Sbjct: 264 IMWLWLDFGKADQVFVYFWEVVAFCNIMTF 293 >SB_2329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1181 Score = 27.9 bits (59), Expect = 5.6 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +3 Query: 357 VDYSEATNPYISLSKTFSEMNPDFFTMANKIYVGNKYTLDEKF 485 + S AT P+I + T NP+FF ++ + + T DE + Sbjct: 276 IKQSNATTPFIVIQNTLEVKNPNFFEVSLSA-LNQQVTWDEHY 317 >SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19) Length = 3083 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +3 Query: 117 FAVIAVCNVRAFYFFDHEYNRTALGDAIDKTSMKLLKEAYTS 242 + + V ++ + F+H Y+R + AI K S L+KE TS Sbjct: 1218 YGISNVLPLKKAFTFNHTYSRHGIFKAILKGSGNLIKEEVTS 1259 >SB_12515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 769 Score = 27.5 bits (58), Expect = 7.4 Identities = 19/82 (23%), Positives = 35/82 (42%), Gaps = 2/82 (2%) Frame = +3 Query: 177 RTALGDAIDKTSMKLLKEAYTSGKDKNVVSSPLGVMMLMLLYK--SGAGEGSRVEIDKFL 350 R D +D ++ K + ++ G++ + +L S + R+E+ K L Sbjct: 529 RMRFSDTVDIVDVEEAKRLHREALKQSATDPKTGLIDISILTTGLSASDRKRRLELAKSL 588 Query: 351 GDVDYSEATNPYISLSKTFSEM 416 + S+ P + KTFSEM Sbjct: 589 KALLTSKGKVPTVDYQKTFSEM 610 >SB_42896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 27.5 bits (58), Expect = 7.4 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -1 Query: 406 KVLLRLMY-GLVASL*STSPKNLSISTRLPSPAPDL*RSISIITPNGE 266 K+ R +Y +V L S ++L+I R PSP+PD R S +P+ + Sbjct: 271 KLKTRFLYLKVVIKLEGGSDEDLAILDRSPSPSPDRRRQRSQSSPHSD 318 >SB_29121| Best HMM Match : Toxin_12 (HMM E-Value=8.7) Length = 497 Score = 27.1 bits (57), Expect = 9.8 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 41 LSASVHYCILVVDYARTSQHDQVIFIRGYRGLQRASILFL 160 + S + ++ V Y RTSQ+ ++F+ R Q S++F+ Sbjct: 401 MRTSQNQSLVCVYYMRTSQNQSLVFVYYLRTSQNQSLVFV 440 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,942,679 Number of Sequences: 59808 Number of extensions: 321915 Number of successful extensions: 827 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 824 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -