BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_D01 (461 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 0.69 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 0.69 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 3.7 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 3.7 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 3.7 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 22 3.7 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 22 3.7 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 4.9 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.2 bits (50), Expect = 0.69 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 347 QTPTGLPYALINPSTKASKQYHW-AGPNSILSELG-TLH 457 Q P P + ST +S HW +G N S G TLH Sbjct: 1402 QVPPSAPVLYVTSSTSSSILLHWKSGHNGGASLTGYTLH 1440 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.2 bits (50), Expect = 0.69 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 347 QTPTGLPYALINPSTKASKQYHW-AGPNSILSELG-TLH 457 Q P P + ST +S HW +G N S G TLH Sbjct: 1398 QVPPSAPVLYVTSSTSSSILLHWKSGHNGGASLTGYTLH 1436 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 3.7 Identities = 16/72 (22%), Positives = 34/72 (47%) Frame = +2 Query: 182 WVAEHLHFNEVDTELSVFETTIRFIGGLLSCYSLTGDTVFRDKAVEVADALLPAFQTPTG 361 WV+ L + V +S+ TT+ + S + + V KA+++ + F Sbjct: 260 WVSFWLDQSAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDIWTGVCLTFVFGAL 319 Query: 362 LPYALINPSTKA 397 L +AL+N ++++ Sbjct: 320 LEFALVNYASRS 331 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 3.7 Identities = 16/72 (22%), Positives = 34/72 (47%) Frame = +2 Query: 182 WVAEHLHFNEVDTELSVFETTIRFIGGLLSCYSLTGDTVFRDKAVEVADALLPAFQTPTG 361 WV+ L + V +S+ TT+ + S + + V KA+++ + F Sbjct: 260 WVSFWLDQSAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDIWTGVCLTFVFGAL 319 Query: 362 LPYALINPSTKA 397 L +AL+N ++++ Sbjct: 320 LEFALVNYASRS 331 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 205 QRSRYGAIGIRDNHPVH 255 +R YG + DNH VH Sbjct: 266 RRKNYGGVYHLDNHHVH 282 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 3.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 Query: 377 INPSTKASKQYHWAGPNSILSELGT 451 +NP+ K+ H AGP I + T Sbjct: 515 LNPNEKSLHYLHIAGPGKIQMDSST 539 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 3.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 Query: 377 INPSTKASKQYHWAGPNSILSELGT 451 +NP+ K+ H AGP I + T Sbjct: 515 LNPNEKSLHYLHIAGPGKIQMDSST 539 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 4.9 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -2 Query: 328 VGHFHCFIPEHCVTGQRITRQESTDEPDGCL 236 V F C+ P H + Q S D+P+ L Sbjct: 292 VAFFICWAPFHAQRLLAVYAQNSKDKPEDVL 322 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,512 Number of Sequences: 438 Number of extensions: 2281 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12312900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -