BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_C18 (673 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 35 6e-04 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 3.5 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 22 6.1 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 8.1 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 8.1 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 8.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.1 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 35.1 bits (77), Expect = 6e-04 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = +3 Query: 126 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVK 236 C R RPVC S+GK Y N C L+ R HS + K Sbjct: 110 CPRRHRPVCASNGKIYANHCELH--RAACHSGSSLTK 144 Score = 27.1 bits (57), Expect = 0.16 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 8/71 (11%) Frame = +3 Query: 336 ECSRPLAPSLEMKHRG---ECQEVKVADIQPCICTREI----KQVCGSDGVTYGYPCLLN 494 E SR + P K+ G EC+ + I C+C R+ + VC S+G Y C L+ Sbjct: 74 ESSRSIDPCAS-KYCGIGKECELSPNSTIAVCVCMRKCPRRHRPVCASNGKIYANHCELH 132 Query: 495 -CATQSNPSLS 524 A S SL+ Sbjct: 133 RAACHSGSSLT 143 Score = 25.8 bits (54), Expect = 0.38 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 270 CTFIYAPVCGTDGNTYPNKCSL 335 C + PVC ++G Y N C L Sbjct: 110 CPRRHRPVCASNGKIYANHCEL 131 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 629 CTRNLEPVCASNG 667 C R PVCASNG Sbjct: 110 CPRRHRPVCASNG 122 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 303 DGNTYPNKCSLECSRPLAPSLEMKHR 380 DGN+Y N CSR + + K R Sbjct: 241 DGNSYRNDGERSCSRDRSREYKKKDR 266 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/25 (36%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -2 Query: 312 CSRLCHRPGHI*RY-RRKDRLPHTY 241 C RLC+R G + R+ + +P Y Sbjct: 247 CERLCNRLGRVKRFINWHEPIPEAY 271 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +1 Query: 610 QCTVLCVYQKLGASLCLKRC 669 +C YQ G +CL+ C Sbjct: 149 KCDKCSTYQSNGEEVCLENC 168 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 403 TLTSWHSPRCFIS 365 T SWHSP IS Sbjct: 152 TEASWHSPEAHIS 164 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -2 Query: 252 PHTYPLSRFSNRCASCPSRNTR 187 P YPL RF N P R+ R Sbjct: 67 PSVYPLLRFENPETHHPIRHGR 88 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 8.1 Identities = 14/65 (21%), Positives = 23/65 (35%) Frame = +3 Query: 159 DGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVCGTDGNTYPNKCSLE 338 DGK H+ + + S + + + DP + + A + GT P C Sbjct: 432 DGKLPHDDQPPLSPQSDSSSSSRSAESPMSVQVDPMAASVVAAALTGTYPTLLPQWCLPP 491 Query: 339 CSRPL 353 PL Sbjct: 492 REAPL 496 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,200 Number of Sequences: 438 Number of extensions: 4291 Number of successful extensions: 14 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -