BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_C17 (583 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 26 0.20 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 4.4 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 26.2 bits (55), Expect = 0.20 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +1 Query: 205 VFNSEVQNLNFGKNEEAANIINTWVEDHTNK-RIKNLVDPSSLDSSTQCVL-VNAIYFK 375 VF S L F +E + + ++EDHT + +K + S+D + C +N F+ Sbjct: 133 VFTSGKMKLMFPLMQECVDDLRRFLEDHTEEIDVKTAMKKYSVDIISTCAFGINTYCFR 191 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +1 Query: 37 LLKAIDFPNDNVTKAVFTDLNQKVRSIKGVDLKLANK 147 LLK F DN+ K + + ++++ G ++K K Sbjct: 115 LLKHNLFLLDNIVKPIIAFYYKPIKTLNGHEIKFIRK 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.313 0.132 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,480 Number of Sequences: 336 Number of extensions: 2825 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14517299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits)
- SilkBase 1999-2023 -