BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_C15 (560 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 24 3.9 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 6.8 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 23.8 bits (49), Expect = 3.9 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +2 Query: 392 CKKLKIPSVEPYYIKHYKNGEFHKDYDRSE 481 C LKI + + Y + E H+D+D + Sbjct: 75 CNALKIETNDDYSFLQIEKNEPHRDFDSQQ 104 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.0 bits (47), Expect = 6.8 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +2 Query: 407 IPSVEPYYIKHYKNGEFH 460 IP+++P+ + + N EFH Sbjct: 876 IPNIQPWITRRHGNIEFH 893 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 525,160 Number of Sequences: 2352 Number of extensions: 9658 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -