BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_C14 (503 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24180.1 68417.m03470 pathogenesis-related thaumatin family p... 31 0.58 At2g40770.1 68415.m05030 SNF2 domain-containing protein / helica... 30 0.77 At5g22540.1 68418.m02630 expressed protein contains Pfam profile... 29 1.3 At3g62160.1 68416.m06984 transferase family protein low similari... 29 1.8 At3g52970.1 68416.m05839 cytochrome P450 family protein cytochro... 28 3.1 At5g49850.1 68418.m06173 jacalin lectin family protein similar t... 28 4.1 At5g01770.1 68418.m00096 transducin family protein / WD-40 repea... 27 7.2 At1g17460.1 68414.m02141 myb family transcription factor contain... 27 7.2 At4g10670.1 68417.m01743 transcription elongation factor-related... 27 9.5 At4g04110.1 68417.m00581 Toll-Interleukin-Resistance (TIR) domai... 27 9.5 >At4g24180.1 68417.m03470 pathogenesis-related thaumatin family protein similar to SP|P28493 Pathogenesis-related protein 5 precursor (PR-5) {Arabidopsis thaliana}; contains Pfam profile PF00314: Thaumatin family Length = 255 Score = 30.7 bits (66), Expect = 0.58 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 156 GIVTSLNRRVPREFRYGTQAVCKT 85 G VT LN++ P E R+G+ + CK+ Sbjct: 165 GCVTDLNQKCPTELRFGSGSACKS 188 >At2g40770.1 68415.m05030 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger (C3HC4 type RING finger) family protein low similarity to SP|P36607 DNA repair protein rad8 {Schizosaccharomyces pombe}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 1648 Score = 30.3 bits (65), Expect = 0.77 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +2 Query: 305 ARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLAMCSVQ 448 AR++I T+KR + P+ + +++N L+KL A C Q Sbjct: 719 AREVIETLKRDILKRGHTSSDNPLVTHAEAAKLLNSLLKLRQACCHPQ 766 >At5g22540.1 68418.m02630 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 440 Score = 29.5 bits (63), Expect = 1.3 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 229 EAIRFLDIFEKTFVQSLQKGKFESYGKKIDFHDEKAINFV 348 EA LD+ KTFV + + + + K F+D + + FV Sbjct: 217 EAKHLLDLIRKTFVPVPSQRRIKDHSSKSSFNDHEYLGFV 256 >At3g62160.1 68416.m06984 transferase family protein low similarity to Taxus cuspidata transferases: 10-deacetylbaccatin III-10-O-acetyl transferase GI:6746554, taxadienol acetyl transferase GI:6978038, 2-debenzoyl-7,13-diacetylbaccatin III-2-O-benzoyl transferase GI:11559716; contains Pfam profile PF02458 transferase family Length = 428 Score = 29.1 bits (62), Expect = 1.8 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 Query: 153 IVTSLNRRVPREFRYGTQAVCKTLEVITCC 64 I + L R REFR T +C EVI C Sbjct: 224 IPSDLIERFKREFRASTGEICSAFEVIAAC 253 >At3g52970.1 68416.m05839 cytochrome P450 family protein cytochrome P450 76A2, eggplant, PIR:S38534 Length = 516 Score = 28.3 bits (60), Expect = 3.1 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = +1 Query: 307 KKIDFHDEKAINFVGNYWQENADLYE----EEVTKDY 405 +K FH EKA G + +E ++ E +E TKDY Sbjct: 242 RKTQFHVEKAFEIAGEFIRERTEVREREKSDEKTKDY 278 >At5g49850.1 68418.m06173 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin domain Length = 596 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/59 (20%), Positives = 25/59 (42%) Frame = +1 Query: 19 KHRRGEIYYNFYQQLTTRYYFERLTNGLGSIPEFSWYSPIKTGYYPLMTSYYFPFAQRP 195 K +G F ++ + F + G + WY+P+ GY + ++++P P Sbjct: 386 KTSKGRTSRTFGERTSDSVEFVIESKGCAVVGFHGWYAPLGAGYITALGAHFYPMPLPP 444 >At5g01770.1 68418.m00096 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein mip1 (SP:P87141) [Schizosaccharomyces pombe] Length = 1354 Score = 27.1 bits (57), Expect = 7.2 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = +1 Query: 94 NGLGSIPEFSWYSPIKTGYYPLMTSYYFPFAQRPDNYNLHSVKNYEAIRFLDIFE 258 +GL +IP +W + +TG + + P D V NYE L+ F+ Sbjct: 1004 SGLSNIPIANWDTKFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLLNGFD 1058 >At1g17460.1 68414.m02141 myb family transcription factor contains Pfam PF00249: Myb-like DNA-binding domain Length = 604 Score = 27.1 bits (57), Expect = 7.2 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 239 GSWTFLKRLSYSPY 280 G WT +K+LS+SPY Sbjct: 517 GKWTEIKKLSFSPY 530 >At4g10670.1 68417.m01743 transcription elongation factor-related low similarity to chromatin-specific transcription elongation factor FACT 140 kDa subunit [Homo sapiens] GI:5499741 Length = 470 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/61 (22%), Positives = 33/61 (54%) Frame = +2 Query: 251 FLKRLSYSPYRKANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSL 430 +LK +S+ +S+ + +++ S ++ + +RT + ++KLQ + N+ LSL Sbjct: 61 YLKEVSFRTKDSRHSSDVVQQVKSLRRKVMARESERAERTSLVNQEKLQIVRNNSKPLSL 120 Query: 431 A 433 + Sbjct: 121 S 121 >At4g04110.1 68417.m00581 Toll-Interleukin-Resistance (TIR) domain-containing protein domain signature TIR exists, suggestive of a disease resistance protein. Length = 239 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +2 Query: 278 YRKANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIIND-LMKLSL 430 ++K NR ++ + + ++ T+G + IC + I ND L+KL+L Sbjct: 155 FKKTCQNRTEDEINLRRRALIDVANTLGYHSTICKANMTKEITNDVLVKLNL 206 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,086,679 Number of Sequences: 28952 Number of extensions: 222384 Number of successful extensions: 680 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 679 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 898188928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -