BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
Query= I10A02NGRL0001_C13
         (546 letters)
Database: celegans 
           27,780 sequences; 12,740,198 total letters
Searching..................................................done
                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value
AF016449-11|AAG23992.1|  353|Caenorhabditis elegans Serpentine r...    28   3.8  
>AF016449-11|AAG23992.1|  353|Caenorhabditis elegans Serpentine
           receptor, class t protein7 protein.
          Length = 353
 Score = 28.3 bits (60), Expect = 3.8
 Identities = 12/36 (33%), Positives = 22/36 (61%)
 Frame = +2
Query: 5   CFVIVLKKNLKIHRRMMRLQFVMVTVILMSCSEQAT 112
           CF+ +LK NL++    + L   +V ++ +SC+  AT
Sbjct: 55  CFLAILKLNLRVPVYQLMLFLSIVDMLQLSCNSIAT 90
  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.279   0.0580    0.190 
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,500,387
Number of Sequences: 27780
Number of extensions: 151275
Number of successful extensions: 411
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 391
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 411
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1102518352
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -