BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_C13 (546 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 4.7 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 4.7 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 21 6.2 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 6.2 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 21 8.2 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 21 8.2 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/35 (25%), Positives = 15/35 (42%) Frame = -3 Query: 205 HNILSTIGSFPEKFAQEIWIKIDIYFRAARCRCLF 101 H + G FP + ++W+ + A C LF Sbjct: 336 HMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALF 370 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/35 (25%), Positives = 15/35 (42%) Frame = -3 Query: 205 HNILSTIGSFPEKFAQEIWIKIDIYFRAARCRCLF 101 H + G FP + ++W+ + A C LF Sbjct: 304 HMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALF 338 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -3 Query: 439 NEPIIFIAEFVIYAFTISTVTVRYY 365 NE IF+A +++ I + + YY Sbjct: 206 NEIRIFVATIFTFSYCIPMILIIYY 230 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.4 bits (43), Expect = 6.2 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 Query: 516 WMCAVQYRTR 545 W C +QY TR Sbjct: 531 WNCVIQYNTR 540 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 401 RIYNFDGHRSLLSSV 357 +IY F GH S ++SV Sbjct: 250 KIYLFSGHESNIASV 264 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 401 RIYNFDGHRSLLSSV 357 +IY F GH S ++SV Sbjct: 265 KIYLFSGHESNIASV 279 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,454 Number of Sequences: 438 Number of extensions: 1835 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -