BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_C11 (410 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0273 - 7036125-7037999 27 5.8 09_02_0311 + 7164774-7166327 27 7.7 >03_02_0273 - 7036125-7037999 Length = 624 Score = 27.1 bits (57), Expect = 5.8 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 269 LEHEGKCIYALALPIALVRPESPNAISKRARR 364 +EH+G CI A+ + L E+ + RARR Sbjct: 1 MEHKGLCILAVVIAFQLAGGEAVTDATARARR 32 >09_02_0311 + 7164774-7166327 Length = 517 Score = 26.6 bits (56), Expect = 7.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 314 ALVRPESPNAISKRARRDELR 376 AL PE+PN++ +R RR E R Sbjct: 219 ALFLPETPNSLLERGRRGEAR 239 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,565,309 Number of Sequences: 37544 Number of extensions: 226895 Number of successful extensions: 424 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 730630428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -