BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_C09 (368 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 0.50 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 24 0.66 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 1.5 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 4.6 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 20 8.1 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 20 8.1 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 20 8.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 20 8.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 20 8.1 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.2 bits (50), Expect = 0.50 Identities = 15/51 (29%), Positives = 19/51 (37%) Frame = +2 Query: 71 LPRVWNPDFSLTSTVLRNYTISTGPASSIQSSQLSTQAIRQPSRPWWEVNV 223 +P W + S LR+ IS P L I P WEVN+ Sbjct: 82 MPDGWETEISDQMLELRDLPISGKPFQIRMKHGLIRDLIVDRDVPTWEVNI 132 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 23.8 bits (49), Expect = 0.66 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +3 Query: 12 FSRVWMCRTVVVDNSVHRTDYHVFGTRIFLSH 107 ++RVW T++ +N+ + V T + +SH Sbjct: 84 YNRVWRPDTILYNNADPQYSSAVINTNVIVSH 115 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 1.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 68 RPMHTIVHHDCSAHPYAR 15 +P H +HH S HP A+ Sbjct: 808 QPPHQQLHHHQSTHPQAQ 825 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.0 bits (42), Expect = 4.6 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -1 Query: 149 TPVQCLWYNS 120 TP QCL+YN+ Sbjct: 332 TPDQCLFYNT 341 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 20.2 bits (40), Expect = 8.1 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 Query: 107 STVLRNYTISTGPASSI 157 +TVL TISTG SS+ Sbjct: 279 TTVLTMTTISTGVRSSL 295 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 20.2 bits (40), Expect = 8.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +2 Query: 77 RVWNPDFSLTSTVLRNYTI 133 +VW PD L + NY + Sbjct: 107 KVWKPDIVLFNNADGNYEV 125 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 20.2 bits (40), Expect = 8.1 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +2 Query: 80 VWNPDFSLTSTVLRNYTISTGPASSIQSSQL 172 +W PD L + NY ++ +++ S L Sbjct: 110 IWRPDIVLYNNADGNYEVTLMTKATVYYSGL 140 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 20.2 bits (40), Expect = 8.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -3 Query: 123 FRRTVDVREKSGFQTRGNPSDAHYC 49 F V +R ++T GNP + YC Sbjct: 124 FYLLVSLRIDLPWRTCGNPWNTRYC 148 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 20.2 bits (40), Expect = 8.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -3 Query: 123 FRRTVDVREKSGFQTRGNPSDAHYC 49 F V +R ++T GNP + YC Sbjct: 177 FYLLVSLRIDLPWRTCGNPWNTRYC 201 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,408 Number of Sequences: 438 Number of extensions: 2117 Number of successful extensions: 15 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8804355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -