BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_C06 (451 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC550.09 |||peroxin Pex32 |Schizosaccharomyces pombe|chr 3|||M... 27 1.0 SPBC36.09 |sap61||U2 snRNP-associated protein sap61|Schizosaccha... 25 7.1 SPAPJ698.03c |prp12|sap130|U2 snRNP-associated protein Sap130 |S... 24 9.4 SPAC3A11.04 |||siepin homolog|Schizosaccharomyces pombe|chr 1|||... 24 9.4 >SPCC550.09 |||peroxin Pex32 |Schizosaccharomyces pombe|chr 3|||Manual Length = 535 Score = 27.5 bits (58), Expect = 1.0 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -2 Query: 402 FFY*TKIQQILFLILQSSAFLYVRFSGHLSMHSPP 298 FFY + IL L + A V S L+ HSPP Sbjct: 260 FFYLPIVMSILIFCLPTQALFIVLSSVFLAWHSPP 294 >SPBC36.09 |sap61||U2 snRNP-associated protein sap61|Schizosaccharomyces pombe|chr 2|||Manual Length = 492 Score = 24.6 bits (51), Expect = 7.1 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 184 GLSGWYSHHCE 216 GL GWYSH+ E Sbjct: 221 GLPGWYSHNAE 231 >SPAPJ698.03c |prp12|sap130|U2 snRNP-associated protein Sap130 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1206 Score = 24.2 bits (50), Expect = 9.4 Identities = 15/52 (28%), Positives = 23/52 (44%) Frame = +2 Query: 83 INQSNGVIEPSKATLVYDEQPCNAFGGKCTEAETDCPAGTHITAKGLCPSQQ 238 IN V+ S LVY E + GG+ E + ++T+ L P Q+ Sbjct: 574 INDMQIVVALSNGELVYFEMSDDVEGGQLNEYQERKTLTANVTSLALGPVQE 625 >SPAC3A11.04 |||siepin homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 236 Score = 24.2 bits (50), Expect = 9.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 232 TWTKTFRSDVSTSRTVRFSFGTLPAERITRLF 137 T+ K+F S T+ +VRFS PA+ I +++ Sbjct: 142 TFAKSFNS--ITTLSVRFSVKNTPAQAIVKIY 171 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,553,639 Number of Sequences: 5004 Number of extensions: 30171 Number of successful extensions: 59 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 166231220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -