Samia BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0001_C04
         (437 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF271379-1|AAG49889.1| 1241|Homo sapiens interphotoreceptor matr...    29   9.3  

>AF271379-1|AAG49889.1| 1241|Homo sapiens interphotoreceptor matrix
           proteoglycan 200 protein.
          Length = 1241

 Score = 28.7 bits (61), Expect = 9.3
 Identities = 14/53 (26%), Positives = 25/53 (47%)
 Frame = -3

Query: 246 SPSSQDQQGLHYPE*QPLLEQRIPPPLVQTGCCTSDLAPRTHLLKYPGLKHYA 88
           S    D + +H+PE +PL    + P    T   ++ L    H+ + PG+  Y+
Sbjct: 665 SKYEHDDRSIHFPEEEPLSGPAV-PIFADTAAESASLTLPKHISEVPGVDDYS 716


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 59,459,266
Number of Sequences: 237096
Number of extensions: 1037867
Number of successful extensions: 1923
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1840
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1923
length of database: 76,859,062
effective HSP length: 83
effective length of database: 57,180,094
effective search space used: 3545165828
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)