BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I10A02NGRL0001_C04
(437 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF271379-1|AAG49889.1| 1241|Homo sapiens interphotoreceptor matr... 29 9.3
>AF271379-1|AAG49889.1| 1241|Homo sapiens interphotoreceptor matrix
proteoglycan 200 protein.
Length = 1241
Score = 28.7 bits (61), Expect = 9.3
Identities = 14/53 (26%), Positives = 25/53 (47%)
Frame = -3
Query: 246 SPSSQDQQGLHYPE*QPLLEQRIPPPLVQTGCCTSDLAPRTHLLKYPGLKHYA 88
S D + +H+PE +PL + P T ++ L H+ + PG+ Y+
Sbjct: 665 SKYEHDDRSIHFPEEEPLSGPAV-PIFADTAAESASLTLPKHISEVPGVDDYS 716
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 59,459,266
Number of Sequences: 237096
Number of extensions: 1037867
Number of successful extensions: 1923
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1840
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1923
length of database: 76,859,062
effective HSP length: 83
effective length of database: 57,180,094
effective search space used: 3545165828
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -