BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_C04 (437 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 2.6 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 5.9 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.2 bits (45), Expect = 2.6 Identities = 7/33 (21%), Positives = 18/33 (54%) Frame = -1 Query: 215 IIRSNSHCLNNGFRRHWYKRAVVLLILLPEHIF 117 ++ + + CL + + W +RA+ L++ +F Sbjct: 574 VVLAGATCLGSSIKAMWLRRALASLMVFSLGLF 606 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.0 bits (42), Expect = 5.9 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -3 Query: 168 LVQTGCCTSDLAPRTHLLKY 109 ++ CTS + RTH + Y Sbjct: 139 VITAAICTSGIVGRTHTVGY 158 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,646 Number of Sequences: 438 Number of extensions: 2308 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11327868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -