BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_C03 (424 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2, p... 204 1e-53 At1g06220.2 68414.m00656 elongation factor Tu family protein sim... 144 2e-35 At1g06220.1 68414.m00655 elongation factor Tu family protein sim... 144 2e-35 At5g25230.1 68418.m02991 elongation factor Tu family protein tra... 142 9e-35 At3g22980.1 68416.m02898 elongation factor Tu family protein sim... 93 5e-20 At2g45030.1 68415.m05606 mitochondrial elongation factor, putati... 52 2e-07 At1g45332.1 68414.m05195 mitochondrial elongation factor, putati... 52 2e-07 At1g62750.1 68414.m07082 elongation factor Tu family protein sim... 48 2e-06 At5g13650.2 68418.m01585 elongation factor family protein contai... 41 4e-04 At5g13650.1 68418.m01584 elongation factor family protein contai... 41 4e-04 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 34 0.035 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 31 0.24 At2g28290.2 68415.m03434 chromatin remodeling protein, putative ... 31 0.43 At2g28290.1 68415.m03433 chromatin remodeling protein, putative ... 31 0.43 At1g76950.1 68414.m08958 zinc finger protein (PRAF1) / regulator... 31 0.43 At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-... 30 0.56 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 30 0.74 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 30 0.74 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 29 0.98 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 29 0.98 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 29 1.3 At1g16090.1 68414.m01930 wall-associated kinase-related contains... 29 1.3 At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui... 29 1.7 At2g22300.1 68415.m02646 ethylene-responsive calmodulin-binding ... 29 1.7 At5g07270.1 68418.m00829 ankyrin repeat family protein contains ... 28 2.3 At3g47000.1 68416.m05104 glycosyl hydrolase family 3 protein bet... 28 2.3 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 28 3.0 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 28 3.0 At4g36860.2 68417.m05227 LIM domain-containing protein low simil... 27 4.0 At4g36860.1 68417.m05226 LIM domain-containing protein low simil... 27 4.0 At3g09000.1 68416.m01053 proline-rich family protein 27 4.0 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 27 4.0 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 27 4.0 At5g04590.1 68418.m00458 sulfite reductase / ferredoxin (SIR) id... 27 5.2 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 27 5.2 At5g66840.1 68418.m08427 SAP domain-containing protein contains ... 27 6.9 At3g47010.1 68416.m05105 glycosyl hydrolase family 3 protein bet... 27 6.9 At3g19050.1 68416.m02420 kinesin motor protein-related contains ... 27 6.9 At2g46830.2 68415.m05844 myb-related transcription factor (CCA1)... 27 6.9 At2g46830.1 68415.m05843 myb-related transcription factor (CCA1)... 27 6.9 At2g17250.1 68415.m01992 expressed protein weak similarity to Ri... 27 6.9 At5g38560.1 68418.m04662 protein kinase family protein contains ... 26 9.1 At5g16730.1 68418.m01959 expressed protein weak similarity to mi... 26 9.1 At4g29220.1 68417.m04180 phosphofructokinase family protein simi... 26 9.1 At2g35490.1 68415.m04347 plastid-lipid associated protein PAP, p... 26 9.1 At2g33430.1 68415.m04097 plastid developmental protein DAG, puta... 26 9.1 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 26 9.1 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 26 9.1 At1g33720.1 68414.m04169 cytochrome P450, putative similar to SP... 26 9.1 At1g30050.1 68414.m03674 hypothetical protein 26 9.1 At1g27100.1 68414.m03303 expressed protein contains Pfam profil... 26 9.1 >At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2, putative similar to ELONGATION FACTOR 2 GB:O14460 from [Schizosaccharomyces pombe] Length = 843 Score = 204 bits (499), Expect = 1e-53 Identities = 90/140 (64%), Positives = 113/140 (80%) Frame = +3 Query: 3 DAIHRGGGQIIPTTRRCLYACLLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVF 182 DAIHRGGGQ+IPT RR +YA +TA+PRL+EPVY+ EIQ PE A+GGIY VLN++RGHVF Sbjct: 697 DAIHRGGGQVIPTARRVIYASQITAKPRLLEPVYMVEIQAPEGALGGIYSVLNQKRGHVF 756 Query: 183 EESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPCEPNSKP 362 EE Q GTP++ +KAYLPV ESFGF++ LR+ T GQAFPQCVFDHW+++ DP EP ++ Sbjct: 757 EEMQRPGTPLYNIKAYLPVVESFGFSSQLRAATSGQAFPQCVFDHWEMMSSDPLEPGTQA 816 Query: 363 YVVVQETRKRKGLKEGLPDL 422 V+V + RKRKGLKE + L Sbjct: 817 SVLVADIRKRKGLKEAMTPL 836 >At1g06220.2 68414.m00656 elongation factor Tu family protein similar to Cryptosporidium parvum elongation factor-2 GB:U21667 GI:706974 from [Cryptosporidium parvum] Length = 987 Score = 144 bits (350), Expect = 2e-35 Identities = 68/115 (59%), Positives = 80/115 (69%) Frame = +3 Query: 3 DAIHRGGGQIIPTTRRCLYACLLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVF 182 + +HRG GQ+IPT RR Y+ L A PRLMEPVY EIQ P V IY VL+RRRGHV Sbjct: 813 EPLHRGSGQMIPTARRVAYSAFLMATPRLMEPVYYVEIQTPIDCVTAIYTVLSRRRGHVT 872 Query: 183 EESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPCE 347 + GTP ++VKA+LPV ESFGF DLR +T GQAF VFDHW I+PGDP + Sbjct: 873 SDVPQPGTPAYIVKAFLPVIESFGFETDLRYHTQGQAFCLSVFDHWAIVPGDPLD 927 >At1g06220.1 68414.m00655 elongation factor Tu family protein similar to Cryptosporidium parvum elongation factor-2 GB:U21667 GI:706974 from [Cryptosporidium parvum] Length = 987 Score = 144 bits (350), Expect = 2e-35 Identities = 68/115 (59%), Positives = 80/115 (69%) Frame = +3 Query: 3 DAIHRGGGQIIPTTRRCLYACLLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVF 182 + +HRG GQ+IPT RR Y+ L A PRLMEPVY EIQ P V IY VL+RRRGHV Sbjct: 813 EPLHRGSGQMIPTARRVAYSAFLMATPRLMEPVYYVEIQTPIDCVTAIYTVLSRRRGHVT 872 Query: 183 EESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPCE 347 + GTP ++VKA+LPV ESFGF DLR +T GQAF VFDHW I+PGDP + Sbjct: 873 SDVPQPGTPAYIVKAFLPVIESFGFETDLRYHTQGQAFCLSVFDHWAIVPGDPLD 927 >At5g25230.1 68418.m02991 elongation factor Tu family protein translation Elongation Factor 2, Schizosaccharomyces pombe, PIR:T39902 Length = 973 Score = 142 bits (344), Expect = 9e-35 Identities = 67/115 (58%), Positives = 80/115 (69%) Frame = +3 Query: 3 DAIHRGGGQIIPTTRRCLYACLLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVF 182 + +HRG GQ+IPT RR Y+ L A PRLMEPVY EIQ P V IY VL+RRRG+V Sbjct: 799 EPLHRGSGQMIPTARRVAYSAFLMATPRLMEPVYYVEIQTPIDCVTAIYTVLSRRRGYVT 858 Query: 183 EESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPCE 347 + GTP ++VKA+LPV ESFGF DLR +T GQAF VFDHW I+PGDP + Sbjct: 859 SDVPQPGTPAYIVKAFLPVIESFGFETDLRYHTQGQAFCLSVFDHWAIVPGDPLD 913 >At3g22980.1 68416.m02898 elongation factor Tu family protein similar to eukaryotic translation elongation factor 2 GB:NP_001952 [Homo sapiens] Length = 1015 Score = 93.5 bits (222), Expect = 5e-20 Identities = 41/106 (38%), Positives = 61/106 (57%) Frame = +3 Query: 24 GQIIPTTRRCLYACLLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEESQVAG 203 GQ++ + A +L PR++E +Y CE+ +G +Y VL+RRR + +E G Sbjct: 853 GQVMTAVKDACRAAVLQTNPRIVEAMYFCELNTAPEYLGPMYAVLSRRRARILKEEMQEG 912 Query: 204 TPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDP 341 + +F V AY+PV+ESFGF +LR T G A V HW++L DP Sbjct: 913 SSLFTVHAYVPVSESFGFADELRKGTSGGASALMVLSHWEMLEEDP 958 >At2g45030.1 68415.m05606 mitochondrial elongation factor, putative similar to SP|P25039 Elongation factor G 1, mitochondrial precursor (mEF-G-1) {Saccharomyces cerevisiae}; contains Pfam profiles PF00009: Elongation factor Tu GTP binding domain, PF03764: Elongation factor G domain IV, PF00679: Elongation factor G C-terminus Length = 754 Score = 52.0 bits (119), Expect = 2e-07 Identities = 26/76 (34%), Positives = 42/76 (55%) Frame = +3 Query: 63 CLLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEESQVAGTPMFVVKAYLPVN 242 C A+P ++EPV L E++ P G + G +N+R+G + Q V+ A +P+N Sbjct: 649 CYTAARPVILEPVMLVELKVPTEFQGTVAGDINKRKGIIVGNDQEGDDS--VITANVPLN 706 Query: 243 ESFGFTADLRSNTGGQ 290 FG++ LRS T G+ Sbjct: 707 NMFGYSTSLRSMTQGK 722 >At1g45332.1 68414.m05195 mitochondrial elongation factor, putative similar to mitochondrial elongation factor GI:3917 from [Saccharomyces cerevisiae] Length = 754 Score = 52.0 bits (119), Expect = 2e-07 Identities = 26/76 (34%), Positives = 42/76 (55%) Frame = +3 Query: 63 CLLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEESQVAGTPMFVVKAYLPVN 242 C A+P ++EPV L E++ P G + G +N+R+G + Q V+ A +P+N Sbjct: 649 CYTAARPVILEPVMLVELKVPTEFQGTVAGDINKRKGIIVGNDQEGDDS--VITANVPLN 706 Query: 243 ESFGFTADLRSNTGGQ 290 FG++ LRS T G+ Sbjct: 707 NMFGYSTSLRSMTQGK 722 >At1g62750.1 68414.m07082 elongation factor Tu family protein similar to elongation factor G SP:P34811 [Glycine max (Soybean)] Length = 783 Score = 48.4 bits (110), Expect = 2e-06 Identities = 26/73 (35%), Positives = 40/73 (54%) Frame = +3 Query: 75 AQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEESQVAGTPMFVVKAYLPVNESFG 254 A PR++EP+ E+ PE +G + G LN RRG + G + VV + +P+ E F Sbjct: 683 AGPRMLEPIMRVEVVTPEEHLGDVIGDLNSRRGQINSFGDKPG-GLKVVDSLVPLAEMFQ 741 Query: 255 FTADLRSNTGGQA 293 + + LR T G+A Sbjct: 742 YVSTLRGMTKGRA 754 >At5g13650.2 68418.m01585 elongation factor family protein contains Pfam profiles: PF00009 elongation factor Tu GTP binding domain,PF00679 elongation factor G C-terminus, PF03144 elongation factor Tu domain 2 Length = 676 Score = 40.7 bits (91), Expect = 4e-04 Identities = 21/85 (24%), Positives = 39/85 (45%) Frame = +3 Query: 84 RLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEESQVAGTPMFVVKAYLPVNESFGFTA 263 +L+EP + ++ PE +G + +L +RRG +F+ V ++ +P G Sbjct: 473 KLLEPYEIATVEVPEAHMGPVVELLGKRRGQMFDMQGVGSEGTTFLRYKIPTRGLLGLRN 532 Query: 264 DLRSNTGGQAFPQCVFDHWQILPGD 338 + + + G A VFD + GD Sbjct: 533 AILTASRGTAILNTVFDSYGPWAGD 557 >At5g13650.1 68418.m01584 elongation factor family protein contains Pfam profiles: PF00009 elongation factor Tu GTP binding domain,PF00679 elongation factor G C-terminus, PF03144 elongation factor Tu domain 2 Length = 675 Score = 40.7 bits (91), Expect = 4e-04 Identities = 21/85 (24%), Positives = 39/85 (45%) Frame = +3 Query: 84 RLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEESQVAGTPMFVVKAYLPVNESFGFTA 263 +L+EP + ++ PE +G + +L +RRG +F+ V ++ +P G Sbjct: 472 KLLEPYEIATVEVPEAHMGPVVELLGKRRGQMFDMQGVGSEGTTFLRYKIPTRGLLGLRN 531 Query: 264 DLRSNTGGQAFPQCVFDHWQILPGD 338 + + + G A VFD + GD Sbjct: 532 AILTASRGTAILNTVFDSYGPWAGD 556 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 34.3 bits (75), Expect = 0.035 Identities = 31/86 (36%), Positives = 38/86 (44%), Gaps = 7/86 (8%) Frame = +1 Query: 181 SRSRKSPAHPCSW*RRTCPSTSR--SGSPPTC---APTPEGR--RSRSASSITGRSCPET 339 SR R+SP+ P R P R S SPP +PTP R RS S + RS P Sbjct: 307 SRRRRSPSPPARRRRSPSPPARRRRSPSPPARRHRSPTPPARQRRSPSPPARRHRSPPPA 366 Query: 340 RASPTPSHTLSYRKQERGKA*RKVSP 417 R +PS R+ A R+ SP Sbjct: 367 RRRRSPSPPARRRRSPSPPARRRRSP 392 Score = 30.3 bits (65), Expect = 0.56 Identities = 25/67 (37%), Positives = 32/67 (47%) Frame = +2 Query: 215 RGEGVPARQRVVRVHRRPALQHRRAGVPAVRLRSLADPARRPVRAQLQAIRCRTGNKKEE 394 R PAR+R R PA +HR PA + RS + PARR R+ A R R+ + Sbjct: 321 RSPSPPARRR--RSPSPPARRHRSPTPPARQRRSPSPPARRH-RSPPPARRRRSPSPPAR 377 Query: 395 RLEGRSP 415 R SP Sbjct: 378 RRRSPSP 384 Score = 27.5 bits (58), Expect = 4.0 Identities = 25/64 (39%), Positives = 27/64 (42%), Gaps = 3/64 (4%) Frame = +1 Query: 235 PSTSRSGSPPTC--APTPEGRRSRSASSITGRS-CPETRASPTPSHTLSYRKQERGKA*R 405 P SRS SP PT EGRR A S RS P R +PS R+ A R Sbjct: 280 PFRSRSRSPIRRHRRPTHEGRRQSPAPSRRRRSPSPPARRRRSPSPPARRRRSPSPPARR 339 Query: 406 KVSP 417 SP Sbjct: 340 HRSP 343 Score = 26.6 bits (56), Expect = 6.9 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 271 APTPEGRRSRSASSITGRSCPETRASPTPSHTLS 372 +PTP RRSR +SS + R SP+ S + S Sbjct: 585 SPTPVNRRSRRSSSASRSPDRRRRRSPSSSRSPS 618 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 31.5 bits (68), Expect = 0.24 Identities = 21/45 (46%), Positives = 26/45 (57%), Gaps = 4/45 (8%) Frame = +1 Query: 235 PSTSRS-GSPPT--CAPTPEGRRSRSASSIT-GRSCPETRASPTP 357 PST+ S GSPPT PTP G S ++ T G S P + +PTP Sbjct: 459 PSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTP 503 Score = 29.1 bits (62), Expect = 1.3 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 Query: 235 PSTSRSGSPPTCAPTPEGRRSRSASSITGRSCPETRASPTP 357 PS S SPP+ P+P + + G S P + +PTP Sbjct: 450 PSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTP 490 Score = 27.9 bits (59), Expect = 3.0 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 229 TCPSTSRSGSPPTCAPTPEGRRSRSASSITGRSCPETRASPTPS 360 T PS S P+ +P+P S+ T P + +SPTPS Sbjct: 512 TTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPS 555 Score = 27.1 bits (57), Expect = 5.2 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = +1 Query: 229 TCPST-SRSGSPPTC--APTPEGRRSRSASSIT-GRSCPETRASPTP 357 T P+T + GSPP+ PTP G S ++ T G S P + +P+P Sbjct: 470 TSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSP 516 >At2g28290.2 68415.m03434 chromatin remodeling protein, putative (SYD) similar to transcriptional activator HBRM [Homo sapiens] GI:414117; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; identical to cDNA putative chromatin remodeling protein SYD (SPLAYED) GI:13603720 Length = 3529 Score = 30.7 bits (66), Expect = 0.43 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -1 Query: 295 NACPPVLERRSAVNPNDSLTGRYAFTTNMGVPATCDSSNT 176 N+ P E + A NP+D L G TT V TC SN+ Sbjct: 3473 NSSLPKTEEKDAENPSDRLDGESDGTTVATVEGTCVESNS 3512 >At2g28290.1 68415.m03433 chromatin remodeling protein, putative (SYD) similar to transcriptional activator HBRM [Homo sapiens] GI:414117; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; identical to cDNA putative chromatin remodeling protein SYD (SPLAYED) GI:13603720 Length = 3574 Score = 30.7 bits (66), Expect = 0.43 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -1 Query: 295 NACPPVLERRSAVNPNDSLTGRYAFTTNMGVPATCDSSNT 176 N+ P E + A NP+D L G TT V TC SN+ Sbjct: 3518 NSSLPKTEEKDAENPSDRLDGESDGTTVATVEGTCVESNS 3557 >At1g76950.1 68414.m08958 zinc finger protein (PRAF1) / regulator of chromosome condensation (RCC1) family protein identical to zinc finger protein PRAF1 [Arabidopsis thaliana] gi|15811367|gb|AAL08940. Length = 1103 Score = 30.7 bits (66), Expect = 0.43 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 262 PTCAPTPEGRRSRSASSITGRSCPETRASPTPS 360 P A P G SRS S + RS P A+P PS Sbjct: 785 PKLAQAPSGISSRSVSPFSRRSSPPRSATPMPS 817 >At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-binding protein GUF1 - Saccharomyces cerevisiae, PIR:S50374 Length = 661 Score = 30.3 bits (65), Expect = 0.56 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +3 Query: 93 EPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEESQVAGTPMFVVKAYLPVNE-SFGFTADL 269 EP + I P VG + + + RRG E + + +F +K LP+ E F +L Sbjct: 466 EPTVIATIILPSEYVGAVINLCSDRRGQQLEYTFIDAQRVF-LKYQLPLREIVVDFYDEL 524 Query: 270 RSNTGGQA 293 +S T G A Sbjct: 525 KSITSGYA 532 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 29.9 bits (64), Expect = 0.74 Identities = 23/59 (38%), Positives = 32/59 (54%) Frame = +1 Query: 181 SRSRKSPAHPCSW*RRTCPSTSRSGSPPTCAPTPEGRRSRSASSITGRSCPETRASPTP 357 SR R+SP+ S R + S SRSGS P+ + + RSRS SS + S + S +P Sbjct: 5 SRGRRSPSVSGSSSRSS--SRSRSGSSPSRSISRSRSRSRSLSSSSSPSRSVSSGSRSP 61 Score = 28.7 bits (61), Expect = 1.7 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +1 Query: 271 APTPEGRRSRSASSITGRSCPETRASPTPSHTLSYRKQERGKA 399 A GRRS S S + RS +R+ +PS ++S R + R ++ Sbjct: 2 AKPSRGRRSPSVSGSSSRSSSRSRSGSSPSRSIS-RSRSRSRS 43 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 29.9 bits (64), Expect = 0.74 Identities = 23/59 (38%), Positives = 32/59 (54%) Frame = +1 Query: 181 SRSRKSPAHPCSW*RRTCPSTSRSGSPPTCAPTPEGRRSRSASSITGRSCPETRASPTP 357 SR R+SP+ S R + S SRSGS P+ + + RSRS SS + S + S +P Sbjct: 5 SRGRRSPSVSGSSSRSS--SRSRSGSSPSRSISRSRSRSRSLSSSSSPSRSVSSGSRSP 61 Score = 28.7 bits (61), Expect = 1.7 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +1 Query: 271 APTPEGRRSRSASSITGRSCPETRASPTPSHTLSYRKQERGKA 399 A GRRS S S + RS +R+ +PS ++S R + R ++ Sbjct: 2 AKPSRGRRSPSVSGSSSRSSSRSRSGSSPSRSIS-RSRSRSRS 43 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 29.5 bits (63), Expect = 0.98 Identities = 19/43 (44%), Positives = 22/43 (51%) Frame = +1 Query: 181 SRSRKSPAHPCSW*RRTCPSTSRSGSPPTCAPTPEGRRSRSAS 309 SRSR S R STSRS P + + +P RRSRS S Sbjct: 229 SRSRSRSPKAKSSRRSPAKSTSRSPGPRSKSRSPSPRRSRSRS 271 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 29.5 bits (63), Expect = 0.98 Identities = 19/43 (44%), Positives = 22/43 (51%) Frame = +1 Query: 181 SRSRKSPAHPCSW*RRTCPSTSRSGSPPTCAPTPEGRRSRSAS 309 SRSR S R STSRS P + + +P RRSRS S Sbjct: 229 SRSRSRSPKAKSSRRSPAKSTSRSPGPRSKSRSPSPRRSRSRS 271 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 29.1 bits (62), Expect = 1.3 Identities = 20/57 (35%), Positives = 26/57 (45%) Frame = +1 Query: 196 SPAHPCSW*RRTCPSTSRSGSPPTCAPTPEGRRSRSASSITGRSCPETRASPTPSHT 366 SPAH S T S S S SP TP +S S ++ S P+ A+P+ T Sbjct: 264 SPAHSPSHSPATPKSPSPSSSPAQSPATPSPMTPQSPSPVSSPS-PDQSAAPSDQST 319 >At1g16090.1 68414.m01930 wall-associated kinase-related contains similarity to wall-associated kinase 2 GI:4826399 from [Arabidopsis thaliana]; similar to wall-associated kinase 1 (GI:3549626) [Arabidopsis thaliana]; contains one transmembrane domain Length = 317 Score = 29.1 bits (62), Expect = 1.3 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 383 CFLYDNVWLGVGLARVSGQDLPVIEDALRE 294 C+L +N W V R SG LPV++ RE Sbjct: 55 CYLNNNEWYEVICNRTSGNPLPVLKSINRE 84 >At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1888 Score = 28.7 bits (61), Expect = 1.7 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +1 Query: 235 PSTSRSGSPP---TCAPTPEGRRSRSASSITGRSCPETRASPTPSHTLSYR 378 PS+S S PP PT +R+R +SS + P +S T + + S R Sbjct: 16 PSSSSSSPPPPPSASGPTTRSKRARLSSSSSSSLAPTPPSSSTTTRSRSSR 66 >At2g22300.1 68415.m02646 ethylene-responsive calmodulin-binding protein, putative (SR1) identical to partial sequence of ethylene-induced calmodulin-binding protein GI:11545505 from [Arabidopsis thaliana]; contains Pfam profiles PF03859: CG-1 domain, PF00612: IQ calmodulin-binding motif, and PF00023: Ankyrin repeat Length = 1032 Score = 28.7 bits (61), Expect = 1.7 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = -3 Query: 200 GDLRLLEHVPAPSVQHAVDTTDRHLRTLDLAKVHGFHKPGLRGQQT 63 GD EH S + H +T D A V+GFH P L ++ Sbjct: 161 GDALTSEHDGYASCSFNQNDHSNHSQTTDSASVNGFHSPELEDAES 206 >At5g07270.1 68418.m00829 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 513 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 256 SPPTCAPTPE-GRRSRSASSITGRSCPETRASPTPS 360 S PTC PT + ++R+AS + CP T SP PS Sbjct: 402 SSPTCPPTEQRSSKTRAASVSSDIFCPVT-CSPFPS 436 >At3g47000.1 68416.m05104 glycosyl hydrolase family 3 protein beta-D-glucan exohydrolase, Nicotiana tabacum, TREMBL:AB017502_1 Length = 608 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = -1 Query: 283 PVLERRSAVNPNDSLTGRYAFTTNMGVPATCDSSNTCPRRLFSTP*IPPTATSGHW 116 P++ AV+ N+++ G F N+G+ AT D+ RR+ + + A+ HW Sbjct: 94 PIIYGTDAVHGNNNVYGATVFPHNIGLGATRDAD--LVRRIGAATALEVRASGVHW 147 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 27.9 bits (59), Expect = 3.0 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = +1 Query: 235 PSTSRSGSPPTCAPTPEGRRSRSASSITGRSCPETRASP---TPSHTLSYRKQER 390 P+ + P P+ RRSRS S RS +R+ P +P + S R++ R Sbjct: 96 PNAEKISKGRVVEPPPKSRRSRSRSPRRSRSPRRSRSPPRRRSPRRSRSPRRRSR 150 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 27.9 bits (59), Expect = 3.0 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = +1 Query: 235 PSTSRSGSPPTCAPTPEGRRSRSASSITGRSCPETRASP---TPSHTLSYRKQER 390 P+ + P P+ RRSRS S RS +R+ P +P + S R++ R Sbjct: 96 PNAEKISKGRVVEPPPKSRRSRSRSPRRSRSPRRSRSPPRRRSPRRSRSPRRRSR 150 >At4g36860.2 68417.m05227 LIM domain-containing protein low similarity to LIM-domain protein [Branchiostoma floridae] GI:3360516, DRAL/Slim3/FHL2 [Homo sapiens] GI:7209525; contains Pfam profile PF00412: LIM domain Length = 547 Score = 27.5 bits (58), Expect = 4.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 202 AHPCSW*RRTCPSTSRSGSPPTCA 273 AHP W ++ CPS R G+P C+ Sbjct: 260 AHPF-WMQKYCPSHERDGTPRCCS 282 >At4g36860.1 68417.m05226 LIM domain-containing protein low similarity to LIM-domain protein [Branchiostoma floridae] GI:3360516, DRAL/Slim3/FHL2 [Homo sapiens] GI:7209525; contains Pfam profile PF00412: LIM domain Length = 351 Score = 27.5 bits (58), Expect = 4.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 202 AHPCSW*RRTCPSTSRSGSPPTCA 273 AHP W ++ CPS R G+P C+ Sbjct: 64 AHPF-WMQKYCPSHERDGTPRCCS 86 >At3g09000.1 68416.m01053 proline-rich family protein Length = 541 Score = 27.5 bits (58), Expect = 4.0 Identities = 20/64 (31%), Positives = 27/64 (42%) Frame = +1 Query: 181 SRSRKSPAHPCSW*RRTCPSTSRSGSPPTCAPTPEGRRSRSASSITGRSCPETRASPTPS 360 SRS PA P R T P+TS S T A S +++T + A+P + Sbjct: 153 SRSTSRPATPTR--RSTTPTTSTSRPVTTRASNSRSSTPTSRATLTAARATTSTAAPRTT 210 Query: 361 HTLS 372 T S Sbjct: 211 TTSS 214 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 27.5 bits (58), Expect = 4.0 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 6/65 (9%) Frame = +1 Query: 187 SRKSPAHPCSW*RRTCPST-SRSGSP--PTCAPTPEGRRSRSASSITGRSCPE---TRAS 348 S +P+HP PST S + +P P+ PTP S + S P T + Sbjct: 66 SPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCNCGSPPSHPSTPSHPSTPSH 125 Query: 349 PTPSH 363 PTPSH Sbjct: 126 PTPSH 130 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 27.5 bits (58), Expect = 4.0 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 6/65 (9%) Frame = +1 Query: 187 SRKSPAHPCSW*RRTCPST-SRSGSP--PTCAPTPEGRRSRSASSITGRSCPE---TRAS 348 S +P+HP PST S + +P P+ PTP S + S P T + Sbjct: 66 SPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCNCGSPPSHPSTPSHPSTPSH 125 Query: 349 PTPSH 363 PTPSH Sbjct: 126 PTPSH 130 >At5g04590.1 68418.m00458 sulfite reductase / ferredoxin (SIR) identical to sulfite reductase [Arabidopsis thaliana] GI:804953, GI:2584721 Length = 642 Score = 27.1 bits (57), Expect = 5.2 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -1 Query: 277 LERRSAVNPNDSL-TGRYAFTTNMGVPATCDSSNTCPRRLFSTP*IPPTAT 128 L R A+ + S+ GRY + VP + SS++ P + STP P TAT Sbjct: 23 LGRLDALRSSHSVFLGRYG-RGGVPVPPSASSSSSSPIQAVSTPAKPETAT 72 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 27.1 bits (57), Expect = 5.2 Identities = 20/52 (38%), Positives = 23/52 (44%) Frame = +1 Query: 172 GTCSRSRKSPAHPCSW*RRTCPSTSRSGSPPTCAPTPEGRRSRSASSITGRS 327 GT R KS + RR+ RS SP +P P RRS S GRS Sbjct: 119 GTGRRRSKSRSRTPPRYRRSPSYGRRSYSPRARSPPPPRRRSPSPPPARGRS 170 >At5g66840.1 68418.m08427 SAP domain-containing protein contains Pfam domain PF02037: SAP domain Length = 551 Score = 26.6 bits (56), Expect = 6.9 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +1 Query: 235 PSTSRSGSPPTCAPTPEGRRSRSASSITGRSCPETRASPTPSHTLSYRKQE 387 P RS +PPT AP P RS + P R + P H+ +Y +Q+ Sbjct: 342 PHAPRSHAPPTYAPRPHAPRSYAP---INSHLP--RPNIPPYHSYTYSEQQ 387 >At3g47010.1 68416.m05105 glycosyl hydrolase family 3 protein beta-D-glucan exohydrolase, Nicotiana tabacum, TREMBL:AB017502_1 Length = 581 Score = 26.6 bits (56), Expect = 6.9 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = -1 Query: 283 PVLERRSAVNPNDSLTGRYAFTTNMGVPATCDSSNTCPRRLFSTP*IPPTATSGHW 116 P++ AV+ N+++ G F N+G+ AT D+ +R+ + + A+ HW Sbjct: 67 PIIYGTDAVHGNNNVYGATVFPHNIGLGATRDAD--LVKRIGAATALEIRASGVHW 120 >At3g19050.1 68416.m02420 kinesin motor protein-related contains Pfam profile: PF00225 Kinesin motor domain; contains non-consensus splice site (GC) at intron 12 Length = 2722 Score = 26.6 bits (56), Expect = 6.9 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +1 Query: 175 TCSRSRKSPAHPCSW*RRTCPSTSRSGSPPTCAP--TPEGRRSRSASS 312 T + S K+P H C PS R+ +P P TP+ RS +A S Sbjct: 34 TSNDSLKNPKHECGSKIDRTPSKPRAKNPDPALPLRTPDKYRSAAAFS 81 >At2g46830.2 68415.m05844 myb-related transcription factor (CCA1) identical to myb-related transcription factor (CCA1) GI:4090569 from [Arabidopsis thaliana] Length = 526 Score = 26.6 bits (56), Expect = 6.9 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +1 Query: 250 SGSPPTCAPTPEGRRSRSASSITGRSC--PETRASPTPSHTLSYRKQERGKA 399 +G P CAP G + S G SC T+AS ++ R+QE +A Sbjct: 243 NGLLPLCAPLSSGGFTSHPPSTFGPSCDVEYTKASTLQHGSVQSREQEHSEA 294 >At2g46830.1 68415.m05843 myb-related transcription factor (CCA1) identical to myb-related transcription factor (CCA1) GI:4090569 from [Arabidopsis thaliana] Length = 608 Score = 26.6 bits (56), Expect = 6.9 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +1 Query: 250 SGSPPTCAPTPEGRRSRSASSITGRSC--PETRASPTPSHTLSYRKQERGKA 399 +G P CAP G + S G SC T+AS ++ R+QE +A Sbjct: 325 NGLLPLCAPLSSGGFTSHPPSTFGPSCDVEYTKASTLQHGSVQSREQEHSEA 376 >At2g17250.1 68415.m01992 expressed protein weak similarity to Ribosome biogenesis protein MAK21 (Swiss-Prot:Q12176) [Saccharomyces cerevisiae] Length = 577 Score = 26.6 bits (56), Expect = 6.9 Identities = 16/66 (24%), Positives = 23/66 (34%) Frame = +3 Query: 33 IPTTRRCLYACLLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEESQVAGTPM 212 I + L + LT P L P LC+ +GG+ V+ + P Sbjct: 295 IDVYKEVLASIHLTVIPHLSNPTMLCDFLTKSYDIGGVVSVMALSSLFILMTQHGLEYPF 354 Query: 213 FVVKAY 230 F K Y Sbjct: 355 FYEKLY 360 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 26.2 bits (55), Expect = 9.1 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +1 Query: 196 SPAHPCSW*RRTCPSTSRSGSPPTCAPTPEGRRSRSASSITGRSCPETRASPTP 357 SP+ P T P S SPP P+P G P T SP P Sbjct: 122 SPSPPAP--TTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPP 173 >At5g16730.1 68418.m01959 expressed protein weak similarity to microtubule binding protein D-CLIP-190 [Drosophila melanogaster] GI:2773363, SMC2-like condensin [Arabidopsis thaliana] GI:14279543 Length = 853 Score = 26.2 bits (55), Expect = 9.1 Identities = 24/64 (37%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = +1 Query: 175 TCSRSRKSPAHPCSW*RRTCPS-TSRSGSPPTCAPTPEGRRSRSASSITGRSCPETRAS- 348 T + SPA P R S TS + SP T TP R S SS +S E R+ Sbjct: 16 TTPTGKSSPATPRIAKRTVNKSETSNNNSPSTT--TPHSRLSLDRSSPNSKSSVERRSPK 73 Query: 349 -PTP 357 PTP Sbjct: 74 LPTP 77 >At4g29220.1 68417.m04180 phosphofructokinase family protein similar to phosphofructokinase [Amycolatopsis methanolica] GI:17432243; contains Pfam profile PF00365: Phosphofructokinase Length = 473 Score = 26.2 bits (55), Expect = 9.1 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 2/85 (2%) Frame = +3 Query: 9 IHRGGGQIIPTTR--RCLYACLLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVF 182 IHR GG I+ T+R + + Q R + VY+ + I+ + +R+ V Sbjct: 153 IHRSGGTILGTSRGGHNTTKIVDSIQDRGINQVYIIGGDGSQKGAAAIFEEIRKRKLKV- 211 Query: 183 EESQVAGTPMFVVKAYLPVNESFGF 257 VAG P + ++ SFGF Sbjct: 212 ---AVAGIPKTIDNDIPIIDRSFGF 233 >At2g35490.1 68415.m04347 plastid-lipid associated protein PAP, putative similar to plastid-lipid associated protein PAP3 [Brassica rapa] GI:14248552; contains Pfam profile PF04755: PAP_fibrillin Length = 376 Score = 26.2 bits (55), Expect = 9.1 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +3 Query: 306 VFDHWQILPGDPCEPNSKP-YVVVQETRKRKGLKEGLPDL 422 V D W PGD EP+S+P V V G K G P+L Sbjct: 71 VTDEWGEKPGDANEPDSQPDNVTVNVITDEWGEKSG-PEL 109 >At2g33430.1 68415.m04097 plastid developmental protein DAG, putative similar to DAG protein, chloroplast precursor [Garden snapdragon] SWISS-PROT:Q38732 Length = 219 Score = 26.2 bits (55), Expect = 9.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 228 YLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDP 341 Y P+N F+ D FP C ++HW I+ P Sbjct: 58 YSPLNSGSNFS-DRPPTEMAPLFPGCDYEHWLIVMDKP 94 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 26.2 bits (55), Expect = 9.1 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = +1 Query: 241 TSRSGSPPTCAPTPEGRRSRSASSITGRSCPETRASPTPSHTLS 372 +S S PT PTP S A +++ P +PT S S Sbjct: 692 SSTPSSEPTQVPTPSSSESYQAPNLSPVQAPTPVQAPTTSSETS 735 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 26.2 bits (55), Expect = 9.1 Identities = 18/59 (30%), Positives = 25/59 (42%) Frame = +1 Query: 223 RRTCPSTSRSGSPPTCAPTPEGRRSRSASSITGRSCPETRASPTPSHTLSYRKQERGKA 399 R T P+ S S +PP APT S+ + P T SP+ + + E G A Sbjct: 44 RATAPAPSPSANPPPSAPTTAPPVSQPPTE--SPPAPPTSTSPSGAPGTNVPSGEAGPA 100 >At1g33720.1 68414.m04169 cytochrome P450, putative similar to SP|O64636 Cytochrome P450 76C1 (EC 1.14.-.-) {Arabidopsis thaliana}; contains Pfam profile PF00067: Cytochrome P450 Length = 511 Score = 26.2 bits (55), Expect = 9.1 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = -1 Query: 418 SGRPSFKPFLFLVSCTTTYGLELGSHGSPGRICQ*SKTHCGNACPPVLERRSAV--NPND 245 SG+P F F F++SC + S SP CQ SK+ G P++ V NP+ Sbjct: 5 SGQPLFLIFCFILSCLLFF-TTARSRRSP---CQLSKSPPGPPRLPIIGNIHLVGKNPHH 60 Query: 244 SLT 236 S T Sbjct: 61 SFT 63 >At1g30050.1 68414.m03674 hypothetical protein Length = 389 Score = 26.2 bits (55), Expect = 9.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 Query: 144 YHRPPPPDTGSRKG 103 YH+PP PD G KG Sbjct: 20 YHQPPDPDHGDLKG 33 >At1g27100.1 68414.m03303 expressed protein contains Pfam profile: PF04601 protein of unknown function (DUF569 Length = 519 Score = 26.2 bits (55), Expect = 9.1 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -3 Query: 362 WLGVGLARVSGQDLPVIEDALRERLPSGVGAQVGGEP 252 WL + + G DL + D + S VG++ G EP Sbjct: 141 WLIWDVITIDGSDLENMSDGDESSVSSPVGSEFGSEP 177 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,819,082 Number of Sequences: 28952 Number of extensions: 250287 Number of successful extensions: 1004 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 997 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 655255392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -