BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_C02 (593 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 24 3.2 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 23 5.6 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 7.4 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 23 9.8 AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic pr... 23 9.8 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 9.8 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 136 NLVLVVTGLPLPR*AKSIAPATVGPTSR*FLLN 234 N +L + GLP PR A ++VG ++ FLLN Sbjct: 63 NEILNLLGLPGPRPAVRHLHSSVGKSAPQFLLN 95 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.4 bits (48), Expect = 5.6 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 478 VLSKSACVGIVLAFSTIKVSPFGVNGAEYTT 386 VL +A I A +T+K P GVN Y T Sbjct: 135 VLIVAAGCSICAAQTTVKRYPTGVNATRYGT 165 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 368 NRRXLLCCIFSAVYSEWTHFD 430 ++R +L S +Y+EWT F+ Sbjct: 1129 SKRAILVLSKSFLYNEWTRFE 1149 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 22.6 bits (46), Expect = 9.8 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 295 SAKDFISTAANRASEFLSDSCLIEINGTLVLPSQVQWTSLTLV 167 +AKD A S LI++ G L++ ++ T LTLV Sbjct: 76 TAKDVTLYAIEEGSVAFPRVPLIKVAGPLIIVQLLETTLLTLV 118 >AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic protein protein. Length = 109 Score = 22.6 bits (46), Expect = 9.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 148 VVTGLPLPR*AKSIAPATVGPTSR*FLLNKN 240 V+ L +P +AP+ V P F++N N Sbjct: 23 VLDPLRVPNHTTVVAPSAVSPHQSSFMINNN 53 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 22.6 bits (46), Expect = 9.8 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = -3 Query: 123 EICRWRRPYLEIYRYQHEQQLKAPRLLQTSTFLIIRVTT 7 E CR + LE + EQ A LLQ T L +TT Sbjct: 303 ENCRLAKERLEAAIDEEEQIAAASDLLQVRTALDSSITT 341 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 606,468 Number of Sequences: 2352 Number of extensions: 11904 Number of successful extensions: 64 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -