BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B20 (579 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 25 0.46 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 24 1.1 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 7.6 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 25.0 bits (52), Expect = 0.46 Identities = 7/31 (22%), Positives = 16/31 (51%) Frame = -2 Query: 563 QHRIRRNDVIGGSAIVWQGEMEVLWLEPHIW 471 Q + + ++GG A +W + + L+ +W Sbjct: 539 QLHLNKKQILGGEACLWSEQFDETSLDTRLW 569 Score = 22.6 bits (46), Expect = 2.5 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +3 Query: 183 CPVQISHYLQPQTHYDIFTNIRTSAHRRPYSLQHEQHP 296 C + YL Q ++ T+ +R+PY Q + HP Sbjct: 16 CCILFFIYLYWQQTSNLTTSKLLYTYRQPYPRQKKSHP 53 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 23.8 bits (49), Expect = 1.1 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 289 CSCCSEYGLRWADVRMF 239 C CC E G R A V +F Sbjct: 87 CMCCQESGEREASVSLF 103 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.0 bits (42), Expect = 7.6 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -2 Query: 539 VIGGSAIVWQGEMEVLWLEPHIW 471 V+GG +W ++ LE IW Sbjct: 505 VLGGEVCLWSEQVGPDSLETRIW 527 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,518 Number of Sequences: 336 Number of extensions: 3043 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -