BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B20 (579 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ347217-1|CAC87166.1| 86|Homo sapiens immunoglobulin heavy ch... 31 2.2 >AJ347217-1|CAC87166.1| 86|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 86 Score = 31.5 bits (68), Expect = 2.2 Identities = 17/53 (32%), Positives = 31/53 (58%) Frame = +3 Query: 300 IFYSLSLKDRGKFTRNRKRAVWSVYLYLSVEHLGESLL*WSKRAVDRERWPRR 458 I+Y+ S+K G+FT +R A S+YL ++ ++ + + R + R WPR+ Sbjct: 23 IYYADSVK--GRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARKIRRGSWPRK 73 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,857,147 Number of Sequences: 237096 Number of extensions: 1770978 Number of successful extensions: 4342 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4342 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5985693436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -