BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B19 (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35757| Best HMM Match : Extensin_2 (HMM E-Value=4.7) 27 7.6 SB_13206| Best HMM Match : Extensin_2 (HMM E-Value=0.031) 27 7.6 >SB_35757| Best HMM Match : Extensin_2 (HMM E-Value=4.7) Length = 211 Score = 27.5 bits (58), Expect = 7.6 Identities = 15/50 (30%), Positives = 28/50 (56%) Frame = -3 Query: 396 LQFSIYHSIVSLHNKPLMKSTNSQILYNALHSIRKHLSYYSISNETPYVY 247 L S+Y+S +S++N P+ + +YN+ S+ ++S S+ N VY Sbjct: 74 LPISVYNSPISVYNSPISVYNSPISVYNSPISV--YISSISVYNSPISVY 121 >SB_13206| Best HMM Match : Extensin_2 (HMM E-Value=0.031) Length = 1099 Score = 27.5 bits (58), Expect = 7.6 Identities = 10/49 (20%), Positives = 25/49 (51%) Frame = -3 Query: 384 IYHSIVSLHNKPLMKSTNSQILYNALHSIRKHLSYYSISNETPYVYIYI 238 ++H + N+P+M S ++ + + + + H+S+ N P+ Y+ Sbjct: 731 VFHQPPPVVNQPIMHSHDTYVTHQTVVPLSTHISHAGAYNGVPHEMTYM 779 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,883,762 Number of Sequences: 59808 Number of extensions: 310179 Number of successful extensions: 781 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 768 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -