BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B19 (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 4.7 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 4.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 6.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 6.2 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 8.2 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 4.7 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +1 Query: 439 IQLMRASFKSILNVFLYAI 495 ++++ F SIL +FLYA+ Sbjct: 139 VKVLANEFLSILPIFLYAL 157 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 4.7 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +1 Query: 439 IQLMRASFKSILNVFLYAI 495 ++++ F SIL +FLYA+ Sbjct: 177 VKVLANEFLSILPIFLYAL 195 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 45 RDNNNELKKKARKH 4 RD N E KKK R++ Sbjct: 239 RDRNREYKKKDRRY 252 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 6.2 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 330 SQILYNALHSIRKHLSYYSISNETPYVYIYIHTSS 226 S++L +A HS +S Y ISN + + TS+ Sbjct: 489 SELLGHAFHSQVLSMSDYDISNIEHEALLLVITST 523 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.0 bits (42), Expect = 8.2 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 247 YIYTYKQSLSYVSSFDLRL 191 YIYT K +++ FD+ + Sbjct: 46 YIYTIKSNMAKTLQFDVHM 64 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,508 Number of Sequences: 438 Number of extensions: 3195 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -