BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B18 (639 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 2.7 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 8.2 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.6 bits (51), Expect = 2.7 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +2 Query: 461 LSDLGSSKSEAARNGYSLETRRSETQKFECLSFYL---ATFSNIFILCLHVSVSMLS 622 LS+L KS+ + S T +F +L +TF NI ++C+ S +ML+ Sbjct: 818 LSELSVKKSKKPIPKSNALLIFSPTNRFRIFCHWLCNHSTFGNIILVCIMFSSAMLA 874 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.0 bits (47), Expect = 8.2 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 373 SQFRQVWAVRRXSTPTVQHSWRHR 444 +Q R + +V + T QH+W HR Sbjct: 259 AQDRVMKSVVKEHTKNCQHTWHHR 282 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 697,800 Number of Sequences: 2352 Number of extensions: 14795 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -