BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B16 (672 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 31 0.70 At4g38340.1 68417.m05420 RWP-RK domain-containing protein simila... 30 1.2 At2g33780.1 68415.m04143 VQ motif-containing protein contains PF... 29 3.7 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 29 3.7 At5g59700.1 68418.m07484 protein kinase, putative similar to rec... 28 4.9 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 28 4.9 At1g28520.1 68414.m03506 expressed protein 28 4.9 At1g05370.1 68414.m00544 expressed protein 28 4.9 At3g46960.1 68416.m05099 DEAD/DEAH box helicase, putative simila... 28 6.5 At3g09780.1 68416.m01161 protein kinase family protein contains ... 28 6.5 At5g48010.1 68418.m05933 pentacyclic triterpene synthase, putati... 27 8.6 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 27 8.6 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 27 8.6 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 31.1 bits (67), Expect = 0.70 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 498 PTSYMRGPPESPLHASSPGLPPAHSC 421 P + PP SP+H SSP PP+ C Sbjct: 675 PEVHYHSPPPSPVHYSSPPPPPSAPC 700 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -1 Query: 498 PTSYMRGPPESPLHASSPGLPPAH 427 P Y PP P+H SSP P H Sbjct: 655 PVYYSSPPPPPPVHYSSPPPPEVH 678 >At4g38340.1 68417.m05420 RWP-RK domain-containing protein similar to nodule inception protein GI:6448579 from (Lotus japonicus); contains Pfam profile: PF02042 RWP-RK domain Length = 767 Score = 30.3 bits (65), Expect = 1.2 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -1 Query: 486 MRGPPESPLHASSPGLPPAHSCSL--VI--TSASPPRNVLCAA*HLSLSTYGSLTCCL 325 M GP + LHA + PP+ S SL V+ +S R +L HLSLS + + + CL Sbjct: 1 MVGPFKKILHAHNQRFPPSSSSSLDPVVDDSSRKQTRIILSYLLHLSLSLHITYSLCL 58 >At2g33780.1 68415.m04143 VQ motif-containing protein contains PF05678: VQ motif Length = 204 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 525 TDPTITKVLPTSYMRGPPESPLHASSPGLPPAHS 424 TDP+ K + + G P++P H P PP HS Sbjct: 41 TDPSSFKQV-VQLLTGIPKNPTHQPDPRFPPFHS 73 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 519 PTITKVLPTSYMRGP--PESPLHASSPGLPPAHSCSLVITSASPP 391 P T P S + P P +P A +P PPA + VI+ A+PP Sbjct: 53 PPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPP 97 >At5g59700.1 68418.m07484 protein kinase, putative similar to receptor-like protein kinase [Catharanthus roseus] gi|1644291|emb|CAA97692 Length = 829 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Frame = +3 Query: 267 SPVGECTSSSYLALVCRVQLNNTLNSHM----LIETDVKQRKGHCVGA 398 S +G C ++ + LV N TL SH+ L+ KQR C+G+ Sbjct: 540 SLIGYCDENNEMILVYEYMENGTLKSHLYGSGLLSLSWKQRLEICIGS 587 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 498 PTSYMRGPPESPLHASSPGLPPAHSCSLVITSASPP 391 P + PP P+++ P PP HS + S PP Sbjct: 543 PPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 >At1g28520.1 68414.m03506 expressed protein Length = 486 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 23 NTTNNGPDCMKGTKDCAHPVVTAPIEKTI 109 NTTNN C+KG + V T ++ T+ Sbjct: 433 NTTNNNKRCIKGRPKVSTKVATGNVQNTV 461 >At1g05370.1 68414.m00544 expressed protein Length = 439 Score = 28.3 bits (60), Expect = 4.9 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 255 LKCTSPVGECTSSSYLALVCRVQLNNTLNSHMLIETDVKQRK-GHCVGA 398 LK T +G C SS + V R L +T+ L TD K GH GA Sbjct: 264 LKSTDKIGSCASSRFAFTVSRDGL-DTVKPWCLTLTDTSSTKLGHNTGA 311 >At3g46960.1 68416.m05099 DEAD/DEAH box helicase, putative similar to SP|P35207 Antiviral protein SKI2 {Saccharomyces cerevisiae}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1347 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +2 Query: 59 TKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALI 166 TK C V TAPI KTI + Y D G+ D+ L+ Sbjct: 391 TKHCTRAVYTAPI-KTISNQKY--RDFCGKFDVGLL 423 >At3g09780.1 68416.m01161 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 775 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -2 Query: 638 CSHYFRLLLYFLSMVCTRKRSYIRRGCSLCRNIS 537 CSH F FLS CT I CSLC+N S Sbjct: 388 CSHGF-----FLSSSCTANSDRICTPCSLCQNSS 416 >At5g48010.1 68418.m05933 pentacyclic triterpene synthase, putative similar to pentacyclic triterpene synthase [gi:6650207] [PMID: 11247608] Contains Pfam domain PF00432: Prenyltransferase and squalene oxidase repeat Length = 758 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = -3 Query: 163 KRNVMSALHIVGDVIWMWNSFFYRSSNNGMCTVFGTFHAVRTIV 32 KR + A + D+ + S++ N G+C ++GTF AVR +V Sbjct: 586 KRFITKAAKYIEDMQTVDGSWY---GNWGVCFIYGTFFAVRGLV 626 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 27.5 bits (58), Expect = 8.6 Identities = 26/85 (30%), Positives = 32/85 (37%), Gaps = 1/85 (1%) Frame = -1 Query: 501 LPTSYM-RGPPESPLHASSPGLPPAHSCSLVITSASPPRNVLCAA*HLSLSTYGSLTCCL 325 LP+ Y+ + PP SP SSP PP V S PP + + Y S Sbjct: 46 LPSPYVYKSPPPSPYLYSSPPPPP-----YVYNSPPPPPPYIYNSPPRPPYVYKSPPPPP 100 Query: 324 TVLDKPVPDMNCLYIPQPATYISKS 250 V P P P P Y+ KS Sbjct: 101 FVYSSPPPPTYIYNSPPPPPYVYKS 125 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/50 (30%), Positives = 19/50 (38%) Frame = -1 Query: 567 PGMFLVPQYFGP*LTDPTITKVLPTSYMRGPPESPLHASSPGLPPAHSCS 418 P L P + P + P + PP +H SSP PP H S Sbjct: 416 PSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSS 465 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,085,457 Number of Sequences: 28952 Number of extensions: 419172 Number of successful extensions: 1315 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1309 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -