BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B15 (577 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1827.02c |||cholinephosphate cytidylyltransferase |Schizosac... 26 3.4 SPAC26H5.04 |||vacuolar import and degradation protein Vid28|Sch... 25 6.0 SPBC15C4.05 |||ATP-dependent RNA/DNA helicase |Schizosaccharomyc... 25 7.9 >SPCC1827.02c |||cholinephosphate cytidylyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 354 Score = 26.2 bits (55), Expect = 3.4 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +3 Query: 348 KLQVKLPRRWRLSFSWHLNMTAAVLRSHYMSTQRISSC*ITSF 476 +L V L ++ L H+ + LR+H++ST R I SF Sbjct: 246 ELNVSLFKKNELDLRHHIKVLRDTLRNHWVSTTRDLKADIKSF 288 >SPAC26H5.04 |||vacuolar import and degradation protein Vid28|Schizosaccharomyces pombe|chr 1|||Manual Length = 729 Score = 25.4 bits (53), Expect = 6.0 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -1 Query: 394 QEKLNLHLLGNFTCNLDPNVEFLM 323 QE++ L +L NFTC + +V+FL+ Sbjct: 528 QEQM-LQVLRNFTCQKEESVDFLL 550 >SPBC15C4.05 |||ATP-dependent RNA/DNA helicase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1428 Score = 25.0 bits (52), Expect = 7.9 Identities = 9/35 (25%), Positives = 20/35 (57%) Frame = +2 Query: 173 VAIQKVEVDKLVTYYEYTYVNISASVHMNEVQSQL 277 V++ + ++D Y+E YV+ S S+ +++ L Sbjct: 1356 VSVGQAKLDNFTVYFENVYVSASLSILRRFIETSL 1390 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,237,290 Number of Sequences: 5004 Number of extensions: 43090 Number of successful extensions: 125 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -