BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B14 (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.20 |grx1||glutaredoxin Grx1|Schizosaccharomyces pombe|c... 25 8.4 >SPAC4F10.20 |grx1||glutaredoxin Grx1|Schizosaccharomyces pombe|chr 1|||Manual Length = 101 Score = 25.0 bits (52), Expect = 8.4 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 6/52 (11%) Frame = -1 Query: 466 CHRFEQTVKIDKI------FFLLNSKSKLQSHVIKSEWRYVEPNIIVEFSKH 329 CH E+ + KI L+N+ ++QS+++K + PNI + KH Sbjct: 28 CHATEKVIADKKIKAQVYQIDLMNNGDEIQSYLLKKTGQRTVPNIFIH-QKH 78 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,966,483 Number of Sequences: 5004 Number of extensions: 35203 Number of successful extensions: 98 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -