BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B10 (538 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 24 0.86 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 24 0.86 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 24 0.86 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 24 0.86 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 4.6 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 22 4.6 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 6.0 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 8.0 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 24.2 bits (50), Expect = 0.86 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 285 QAAITYGSFTDTHTISETPSLFILSAF 205 Q AITY D T+ ++PSL L+A+ Sbjct: 211 QTAITYVWKNDEGTLRKSPSLTSLNAY 237 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 24.2 bits (50), Expect = 0.86 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 285 QAAITYGSFTDTHTISETPSLFILSAF 205 Q AITY D T+ ++PSL L+A+ Sbjct: 211 QTAITYVWKNDEGTLRKSPSLTSLNAY 237 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 24.2 bits (50), Expect = 0.86 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 285 QAAITYGSFTDTHTISETPSLFILSAF 205 Q AITY D T+ ++PSL L+A+ Sbjct: 262 QTAITYVWKNDEGTLRKSPSLTSLNAY 288 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 24.2 bits (50), Expect = 0.86 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 285 QAAITYGSFTDTHTISETPSLFILSAF 205 Q AITY D T+ ++PSL L+A+ Sbjct: 211 QTAITYVWKNDEGTLRKSPSLTSLNAY 237 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.8 bits (44), Expect = 4.6 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -2 Query: 519 NSNTS*P*VYLPASMTIQCRQVLRSIPLLCLSLITIEKR 403 + N P + L + T C QV + CL ++ + KR Sbjct: 204 DENIELPQLQLVKNYTADCTQVYSTGNFTCLEVVFVLKR 242 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.8 bits (44), Expect = 4.6 Identities = 18/81 (22%), Positives = 31/81 (38%) Frame = +2 Query: 95 NKVNTCEITAGKKVVLFAVPGAFTPGCSKTHLPGYVQNADKMKSEGVSEIVCVSVNDPYV 274 N ++ ++ + V+ F + GC H P QN D + + + +SV Sbjct: 304 NTQSSAKVMSKNGVLFFGLVNNSAIGCWNEHQPLQRQNMDMVAQNEKTLQMIISVKIIQN 363 Query: 275 MAAWGAQHNTKGKVRMLADPN 337 +A G + MLA N Sbjct: 364 LAYSGRMNRIHKNEYMLALSN 384 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 6.0 Identities = 14/50 (28%), Positives = 18/50 (36%) Frame = -2 Query: 360 SRALMNAPFGSASIRTFPLVLCWAPQAAITYGSFTDTHTISETPSLFILS 211 SR P S S+ L W P G + HTI+ L +S Sbjct: 96 SRLSFLGPIKSLSLSIKMLERIWRPDTYFYNGKHSYVHTITVPNKLLRIS 145 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -1 Query: 340 AIWISKHSYLSLGVVLGTPSGHNIRIV 260 A+W + L+ G+ GTP + R++ Sbjct: 613 AVWFAWGVLLNSGIGEGTPRSFSARVL 639 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,244 Number of Sequences: 438 Number of extensions: 3543 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -