BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B10 (538 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60740.1 68414.m06838 peroxiredoxin type 2, putative strong s... 129 1e-30 At1g65980.1 68414.m07486 peroxiredoxin type 2, putative strong s... 128 2e-30 At1g65970.1 68414.m07485 peroxiredoxin type 2, putative strong s... 128 2e-30 At3g52960.1 68416.m05838 peroxiredoxin type 2, putative similar ... 113 7e-26 At1g65990.1 68414.m07488 type 2 peroxiredoxin-related / thiol sp... 101 3e-22 At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol spe... 94 6e-20 At1g48130.1 68414.m05371 peroxiredoxin (PER1) / rehydrin, putati... 43 1e-04 At3g02890.1 68416.m00284 PHD finger protein-related contains low... 32 0.21 At3g26060.1 68416.m03245 peroxiredoxin Q, putative similar to pe... 32 0.28 At3g61035.1 68416.m06829 cytochrome P450 family protein similar ... 29 2.0 At1g78640.1 68414.m09165 expressed protein ; expression supporte... 29 2.0 At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 28 3.4 At3g18480.1 68416.m02348 CCAAT displacement protein-related / CD... 28 4.5 At5g20390.1 68418.m02425 beta-1,3-glucanase, putative similar to... 27 6.0 At3g45400.1 68416.m04901 exostosin family protein contains Pfam ... 27 6.0 At1g34130.1 68414.m04234 oligosaccharyl transferase STT3 subunit... 27 6.0 At5g05860.1 68418.m00644 UDP-glucoronosyl/UDP-glucosyl transfera... 27 7.9 At2g02480.1 68415.m00187 DNA polymerase-related weak similarity ... 27 7.9 >At1g60740.1 68414.m06838 peroxiredoxin type 2, putative strong similarity to type 2 peroxiredoxin [Brassica rapa subsp. pekinensis] GI:4928472; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 162 Score = 129 bits (311), Expect = 1e-30 Identities = 61/136 (44%), Positives = 92/136 (67%), Gaps = 4/136 (2%) Frame = +2 Query: 32 MAPIKVGDMLP--SLDLF-EDSPANKVNTCEITAGKKVVLFAVPGAFTPGCSKTHLPGYV 202 MAPI VGD++P ++ F E+ V+ I AGKKV+LF VPGAFTP CS +H+PG++ Sbjct: 1 MAPITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFI 60 Query: 203 QNADKMKSEGVSEIVCVSVNDPYVMAAWGAQHNTKGKVRMLADPNGAFIKALDLGTNLPP 382 A+++KS+G+ EI+C SVNDP+VM AWG + V+ +AD +G + L L +L Sbjct: 61 GKAEELKSKGIDEIICFSVNDPFVMKAWGKTYQENKHVKFVADGSGEYTHLLGLELDLKD 120 Query: 383 LG-GFRSKRFSMVIND 427 G G RS+RF++++++ Sbjct: 121 KGLGIRSRRFALLLDN 136 >At1g65980.1 68414.m07486 peroxiredoxin type 2, putative strong similarity to type 2 peroxiredoxin [Brassica rapa subsp. pekinensis] GI:4928472; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 162 Score = 128 bits (310), Expect = 2e-30 Identities = 61/136 (44%), Positives = 91/136 (66%), Gaps = 4/136 (2%) Frame = +2 Query: 32 MAPIKVGDMLP--SLDLF-EDSPANKVNTCEITAGKKVVLFAVPGAFTPGCSKTHLPGYV 202 MAPI VGD++P ++ F E+ + + AGKKV+LF VPGAFTP CS H+PG++ Sbjct: 1 MAPIAVGDVVPDGTISFFDENDQLQTASVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFI 60 Query: 203 QNADKMKSEGVSEIVCVSVNDPYVMAAWGAQHNTKGKVRMLADPNGAFIKALDLGTNLPP 382 + A+++KS+GV EI+C SVNDP+VM AWG + V+ +AD +G + L L +L Sbjct: 61 EKAEELKSKGVDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKD 120 Query: 383 LG-GFRSKRFSMVIND 427 G G RS+RF+++++D Sbjct: 121 KGLGVRSRRFALLLDD 136 >At1g65970.1 68414.m07485 peroxiredoxin type 2, putative strong similarity to type 2 peroxiredoxin [Brassica rapa subsp. pekinensis] GI:4928472; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 162 Score = 128 bits (309), Expect = 2e-30 Identities = 61/136 (44%), Positives = 92/136 (67%), Gaps = 4/136 (2%) Frame = +2 Query: 32 MAPIKVGDMLP--SLDLF-EDSPANKVNTCEITAGKKVVLFAVPGAFTPGCSKTHLPGYV 202 MAPI VGD++P ++ F E+ V+ I AGKKV+LF VPGAFTP CS +H+PG++ Sbjct: 1 MAPITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFI 60 Query: 203 QNADKMKSEGVSEIVCVSVNDPYVMAAWGAQHNTKGKVRMLADPNGAFIKALDLGTNLPP 382 A+++KS+G+ EI+C SVNDP+VM AWG + V+ +AD +G + L L +L Sbjct: 61 GKAEELKSKGIDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKD 120 Query: 383 LG-GFRSKRFSMVIND 427 G G RS+RF++++++ Sbjct: 121 KGLGIRSRRFALLLDN 136 >At3g52960.1 68416.m05838 peroxiredoxin type 2, putative similar to type 2 peroxiredoxin [Brassica rapa subsp. pekinensis] GI:4928472; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 234 Score = 113 bits (272), Expect = 7e-26 Identities = 61/148 (41%), Positives = 89/148 (60%), Gaps = 7/148 (4%) Frame = +2 Query: 5 RALHTSKIAMAPIKVGDMLPSLDLFEDSPAN----KVNTCEITAGKKVVLFAVPGAFTPG 172 R+ T+ + A I VGD LP L P+ V +TAGKK +LFAVPGAFTP Sbjct: 62 RSFATTPVT-ASISVGDKLPDSTLSYLDPSTGDVKTVTVSSLTAGKKTILFAVPGAFTPT 120 Query: 173 CSKTHLPGYVQNADKMKSEGVSEIVCVSVNDPYVMAAWGAQHNTKGKVRMLADPNGAFIK 352 CS+ H+PG+V A +++S+G+ I C+SVND +VM AW +V +L+D NG F Sbjct: 121 CSQKHVPGFVSKAGELRSKGIDVIACISVNDAFVMEAWRKDLGINDEVMLLSDGNGEFTG 180 Query: 353 ALDLGTNL--PPLG-GFRSKRFSMVIND 427 L + +L P+G G RS+R++++ +D Sbjct: 181 KLGVELDLRDKPVGLGVRSRRYAILADD 208 >At1g65990.1 68414.m07488 type 2 peroxiredoxin-related / thiol specific antioxidant / mal allergen family protein similar to type 2 peroxiredoxin [Brassica rapa subsp. pekinensis] GI:4928472; contains Pfam profiles PF00646: F-box domain, PF00578: AhpC/TSA family Length = 553 Score = 101 bits (242), Expect = 3e-22 Identities = 52/136 (38%), Positives = 85/136 (62%), Gaps = 4/136 (2%) Frame = +2 Query: 32 MAPIKVGDMLP--SLDLFEDSPA-NKVNTCEITAGKKVVLFAVPGAFTPGCSKTHLPGYV 202 MAPI VGD +P S+ F+D V+ + AGKKV+LF VPGAF P CS H+ G++ Sbjct: 1 MAPIDVGDFVPDGSISFFDDDDQLQTVSVHSLAAGKKVILFGVPGAFPPTCSMNHVNGFI 60 Query: 203 QNADKMKSEGVSEIVCVSVNDPYVMAAWGAQHNTKGKVRMLADPNGAFIKALDLGTNLPP 382 + A+++KS GV EI+C+S +DP+++ A + V+ + D +G +I+ L L + Sbjct: 61 EKAEELKSNGVDEIICLSGDDPFMITACSENKH----VKFVEDGSGEYIQLLGLELEVKD 116 Query: 383 LG-GFRSKRFSMVIND 427 G G RS+ F++++++ Sbjct: 117 KGLGVRSRGFALLLDN 132 >At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol specific antioxidant (AhpC/TSA)/mal allergen family protein identical to SP|Q9M7T0 Putative peroxiredoxin, mitochondrial precursor {Arabidopsis thaliana}; similar to thioredoxin peroxidase [Capsicum annuum] GI:18654477; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 201 Score = 93.9 bits (223), Expect = 6e-20 Identities = 43/112 (38%), Positives = 68/112 (60%), Gaps = 1/112 (0%) Frame = +2 Query: 113 EITAGKKVVLFAVPGAFTPGCSKTHLPGYVQNADKMKSEGVSEIVCVSVNDPYVMAAWGA 292 +I GKKVV+F +PGA+T CS+ H+P Y + DK K++G+ ++CVSVNDP+ + W Sbjct: 69 DIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFKAKGIDSVICVSVNDPFAINGWAE 128 Query: 293 QHNTKGKVRMLADPNGAFIKALDLGTNL-PPLGGFRSKRFSMVINDRQSRGI 445 + K + D +G F K+L L +L L G RS+R+S + D + + + Sbjct: 129 KLGAKDAIEFYGDFDGKFHKSLGLDKDLSAALLGPRSERWSAYVEDGKVKAV 180 >At1g48130.1 68414.m05371 peroxiredoxin (PER1) / rehydrin, putative identical to peroxiredoxin (Rehydrin homolog) [Arabidopsis thaliana] SWISS-PROT:O04005; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 216 Score = 43.2 bits (97), Expect = 1e-04 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 5/116 (4%) Frame = +2 Query: 32 MAPIKVGDMLPSLDLFEDSPANKVNTCEITAGKKVVLFAVPGAFTPGCSKTHLPGYVQNA 211 M I +GD +P+L++ ++ +K + A VLF+ PG FTP C+ T L + A Sbjct: 1 MPGITLGDTVPNLEV--ETTHDKFKLHDYFANSWTVLFSHPGDFTPVCT-TELGAMAKYA 57 Query: 212 DKMKSEGVSEIVCVSVNDPYVMAAW-----GAQHNTKGKVRMLADPNGAFIKALDL 364 + GV +++ +S +D W H +K ++ADPN I L++ Sbjct: 58 HEFDKRGV-KLLGLSCDDVQSHKDWIKDIEAFNHGSKVNYPIIADPNKEIIPQLNM 112 >At3g02890.1 68416.m00284 PHD finger protein-related contains low similarity to PHD-finger domain proteins Length = 963 Score = 32.3 bits (70), Expect = 0.21 Identities = 21/75 (28%), Positives = 39/75 (52%) Frame = -2 Query: 357 RALMNAPFGSASIRTFPLVLCWAPQAAITYGSFTDTHTISETPSLFILSAFCTYPGK*VL 178 R + G+ ++ + P C A + GS +D S+ S +L++ C++ G +L Sbjct: 4 RGRLEIQSGTCNVCSAPCSSCMHHNAEFS-GSKSDES--SDENSHGVLASQCSFNGDNLL 60 Query: 177 EHPGVNAPGTANKTT 133 GVNAPG+++ T+ Sbjct: 61 RSSGVNAPGSSHNTS 75 >At3g26060.1 68416.m03245 peroxiredoxin Q, putative similar to peroxiredoxin Q [Sedum lineare] GI:6899842; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 216 Score = 31.9 bits (69), Expect = 0.28 Identities = 23/91 (25%), Positives = 43/91 (47%) Frame = +2 Query: 26 IAMAPIKVGDMLPSLDLFEDSPANKVNTCEITAGKKVVLFAVPGAFTPGCSKTHLPGYVQ 205 + A + G P L + + K + + GK VVL+ P TPGC+K + Sbjct: 64 LIFAKVNKGQAAPDFTLKDQN--GKPVSLKKYKGKPVVLYFYPADETPGCTK-QACAFRD 120 Query: 206 NADKMKSEGVSEIVCVSVNDPYVMAAWGAQH 298 + +K K G +E++ +S +D A+ +++ Sbjct: 121 SYEKFKKAG-AEVIGISGDDSASHKAFASKY 150 >At3g61035.1 68416.m06829 cytochrome P450 family protein similar to Cytochrome P450 76C2 (SP:O64637) [Arabidopsis thaliana] Length = 340 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = -1 Query: 460 SGSTFNSSTLPVIDNH*ETFRTESTQRWQVRSEVKSFDECAIWISKHS 317 S +TF+ +L V+D +TF T ++Q +VR +S C I +SK + Sbjct: 112 SMATFDVVSLEVMDTGDKTFLTGASQSHEVRKVEESERTCNISLSKEA 159 >At1g78640.1 68414.m09165 expressed protein ; expression supported by MPSS Length = 487 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = -1 Query: 508 FLTLSLSASEHDNPVPSGSTFNSSTLPVIDNH*ETFRTESTQRWQVRSEVKSFDEC-AIW 332 F+ S + HD + + T ++T P I E E Q W ++ E+ D C + Sbjct: 322 FVDTSSMTNTHDTSLANFQTVPTTTNPKIILKEEKENEEEQQYWTIKKELTKSDACQRLT 381 Query: 331 ISKHS 317 +SK S Sbjct: 382 LSKSS 386 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 28.3 bits (60), Expect = 3.4 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 7/69 (10%) Frame = +2 Query: 242 IVCVSVNDPYVMAAWGAQHNTKGKVRMLADPN-------GAFIKALDLGTNLPPLGGFRS 400 I+ S P+++ W + TKG +R + DPN G+ KA++L + L R Sbjct: 778 IIQQSREKPHIVE-WVSFMITKGDLRSIMDPNLHQDYDIGSVWKAIELAMSCVSLSSARR 836 Query: 401 KRFSMVIND 427 S V+N+ Sbjct: 837 PNMSRVVNE 845 >At3g18480.1 68416.m02348 CCAAT displacement protein-related / CDP-related similar to CCAAT displacement protein (CDP) (Cut-like 1) (Swiss-Prot:P39880) [Homo sapiens]; contains Pfam:PF00904 Involucrin repeat Length = 689 Score = 27.9 bits (59), Expect = 4.5 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -1 Query: 505 LTLSLSASEHDN-PVPSGSTFNSSTLPVIDNH*ETFRTE 392 + +S SE D P PS S+ +SS +PV+ N + F E Sbjct: 1 MEVSQDGSERDKTPPPSSSSSSSSPIPVVTNFWKEFDLE 39 >At5g20390.1 68418.m02425 beta-1,3-glucanase, putative similar to plant beta-1,3-glucanase bg4 GI:2808438 from [Arabidopsis thaliana] Length = 344 Score = 27.5 bits (58), Expect = 6.0 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = -2 Query: 450 RSIPLLCLSLITIEKRFERNPPNGGRFVPRSR 355 RS+P+L + + + + PP+ G F+P++R Sbjct: 151 RSLPILISTTVAMTNLGQSYPPSAGDFMPQAR 182 >At3g45400.1 68416.m04901 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 475 Score = 27.5 bits (58), Expect = 6.0 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -1 Query: 514 EYFLTLSLSASEHDN---PVPSGSTFNSSTLPVI 422 EY+LTL L ASE++N V + +NSS VI Sbjct: 131 EYWLTLDLLASEYENAPRSVAAKRVYNSSEADVI 164 >At1g34130.1 68414.m04234 oligosaccharyl transferase STT3 subunit, putative similar to SP|P39007 Oligosaccharyl transferase STT3 subunit {Saccharomyces cerevisiae}; contains Pfam profile PF02516: Oligosaccharyl transferase STT3 subunit Length = 735 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = -1 Query: 334 WISKHSYLSLGVVLGTPSGHNIRIV---HRHAYYF 239 W++ +Y S +VL H RI+ +R AYY+ Sbjct: 514 WVTAEAYSSPSIVLAARGAHGNRIIFDDYREAYYW 548 >At5g05860.1 68418.m00644 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 450 Score = 27.1 bits (57), Expect = 7.9 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +3 Query: 339 AHSSKLLTSERTCHRWVDSVRNVSQWLSMTGKVEELNVEPDGTGLSCSLAD 491 A SS L T + TC W+D + S G V + E + ++C L++ Sbjct: 241 ASSSSLFTQDETCILWLDDQEDKSVIYVSLGSVVNI-TETEFLEIACGLSN 290 >At2g02480.1 68415.m00187 DNA polymerase-related weak similarity to DNA polymerase III holoenzyme tau subunit [Thermus thermophilus] GI:2583049 Length = 1218 Score = 27.1 bits (57), Expect = 7.9 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +3 Query: 345 SSKLLTSERTCHRWVDSVRNVSQWLSMTGKVEELNVEPDGT-GLSCSLADKL 497 +S + +S T H+WVD + N + L + G EL GT G C L+ L Sbjct: 1090 ASAISSSGLTTHQWVDELNNEVKLLKI-GDNGELQENLTGTRGQHCPLSPSL 1140 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,502,411 Number of Sequences: 28952 Number of extensions: 265177 Number of successful extensions: 785 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 993966856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -