BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B07 (350 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr 1||... 29 0.21 SPBC17A3.03c |||phosphoprotein phosphatase |Schizosaccharomyces ... 27 0.64 SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 25 2.6 SPAC23H3.05c |swd1||COMPASS complex subunit Swd1|Schizosaccharom... 25 4.5 SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizos... 24 7.9 >SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1158 Score = 29.1 bits (62), Expect = 0.21 Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +1 Query: 49 RIDDDKMILITVVLSALVTRVSLTPLCNNTAVSITSNDSPPFNNADPVMQLYNSVIPSVN 228 R+ + + + + L+ TR++ PL + + T D+P N V+++ + +N Sbjct: 573 RLRESRKLELNGYLTKPTTRLARYPLLLSGVLKYTDKDNPDTENIPRVIEMIREFLTKLN 632 Query: 229 YK-GCC*NYLSI 261 Y+ G N LS+ Sbjct: 633 YETGKTENRLSL 644 >SPBC17A3.03c |||phosphoprotein phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 263 Score = 27.5 bits (58), Expect = 0.64 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 151 TSNDSPPFNNADPVMQLYNSVIPSVNYKGCC 243 TSND+ F+N+ V + V P + Y+ C Sbjct: 45 TSNDASTFSNSPLVPDNFGVVYPGIIYRSAC 75 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 25.4 bits (53), Expect = 2.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 91 SALVTRVSLTPLCNNTAVSITSNDSPPFNNA 183 S T S TPL + + + TS S PF N+ Sbjct: 544 STTATSASSTPLTSVNSTTATSASSTPFGNS 574 Score = 25.0 bits (52), Expect = 3.4 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +1 Query: 76 ITVVLSALVTRVSLTPLCNNTAVSITSNDSPPFNNAD 186 +T V S T S TP N+T S S + F N + Sbjct: 555 LTSVNSTTATSASSTPFGNSTITSSASGSTGEFTNTN 591 >SPAC23H3.05c |swd1||COMPASS complex subunit Swd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 398 Score = 24.6 bits (51), Expect = 4.5 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +1 Query: 61 DKMILITVVLSALVTRVSLTPLCNNTAVSITSNDSP 168 D I+ VVLSA V SL P NT V+ ++SP Sbjct: 97 DGSIVYQVVLSAPVWSASLHPHKINTFVASLLDESP 132 >SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizosaccharomyces pombe|chr 3|||Manual Length = 640 Score = 23.8 bits (49), Expect = 7.9 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +1 Query: 73 LITVVLSALVTRVSLTPLCNNTAVSITSNDSPPFNNADPVM 195 LI L ++VSL+P+ + + S+T++ + P+M Sbjct: 288 LIAQNLHTSASQVSLSPMASTASSSVTNSPVDTHTPSTPIM 328 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,132,924 Number of Sequences: 5004 Number of extensions: 17827 Number of successful extensions: 51 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 106195544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -