BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B07 (350 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49918| Best HMM Match : SGS (HMM E-Value=1.5e-07) 31 0.26 SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.26 SB_55935| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_1780| Best HMM Match : Retinin_C (HMM E-Value=7.1) 29 1.1 SB_56617| Best HMM Match : RVT_1 (HMM E-Value=0.04) 29 1.4 SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) 28 2.4 SB_34782| Best HMM Match : zf-CHY (HMM E-Value=0.36) 27 3.2 SB_43688| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_19418| Best HMM Match : Mucin (HMM E-Value=0.024) 27 4.3 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_37009| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) 27 5.7 SB_14565| Best HMM Match : YGGT (HMM E-Value=0.11) 27 5.7 SB_6204| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_3502| Best HMM Match : zf-DBF (HMM E-Value=4.9) 26 9.9 SB_12185| Best HMM Match : AAA_5 (HMM E-Value=0.002) 26 9.9 SB_8007| Best HMM Match : HisKA_3 (HMM E-Value=4.2) 26 9.9 >SB_49918| Best HMM Match : SGS (HMM E-Value=1.5e-07) Length = 227 Score = 31.1 bits (67), Expect = 0.26 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 2/75 (2%) Frame = +1 Query: 13 ISA*VTEIPSRRRIDDDKMILITVVLSALVT--RVSLTPLCNNTAVSITSNDSPPFNNAD 186 +S+ +I S DK + I + L + T + SL P + +V +T N Sbjct: 71 VSSYTKKITSYGWDQSDKFVKIYITLPEVETVPKESLVPNFGDRSVEVTVKGLKGVNYQL 130 Query: 187 PVMQLYNSVIPSVNY 231 + +LY+S++PS +Y Sbjct: 131 QICRLYSSIVPSTSY 145 >SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 31.1 bits (67), Expect = 0.26 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 103 TRVSLTPLCNNTAVSITSNDSPPFNNAD 186 T+ S TP+C + A T+N SP N++D Sbjct: 570 TQSSATPMCQSGATDTTNNQSPAVNSSD 597 >SB_55935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1485 Score = 29.1 bits (62), Expect = 1.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 84 DRNQNHFVVIDSSSRWYLCHSRTDIKFK 1 DR+ FV ++W +CH RTD+ K Sbjct: 851 DRSVEAFVYTVLGAQWRVCHPRTDVHLK 878 >SB_1780| Best HMM Match : Retinin_C (HMM E-Value=7.1) Length = 317 Score = 29.1 bits (62), Expect = 1.1 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 55 DDDKMILITVVLSA-LVTRVSLTPLCNNTAVSITSNDSP 168 DDD L ++ A L S TPLC + + +I DSP Sbjct: 61 DDDPASLANIINEAFLAPMASFTPLCADASPTIPPTDSP 99 >SB_56617| Best HMM Match : RVT_1 (HMM E-Value=0.04) Length = 447 Score = 28.7 bits (61), Expect = 1.4 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 55 DDDKMILITVVLSALVTRV-SLTPLCNNTAVSITSNDSP 168 DDD L ++ A ++ + S TPLC + + +I DSP Sbjct: 111 DDDPASLANIINEAFLSPMASFTPLCADASPTIPPTDSP 149 >SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) Length = 558 Score = 27.9 bits (59), Expect = 2.4 Identities = 11/41 (26%), Positives = 25/41 (60%) Frame = +1 Query: 34 IPSRRRIDDDKMILITVVLSALVTRVSLTPLCNNTAVSITS 156 +P RR +M+++ + +++R++L+P C+N S+ S Sbjct: 375 LPPLRRDYTHQMVVVAPLKVKMISRLTLSPTCSNKPHSLPS 415 >SB_34782| Best HMM Match : zf-CHY (HMM E-Value=0.36) Length = 967 Score = 27.5 bits (58), Expect = 3.2 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = -3 Query: 84 DRNQNHFVVIDSSSRWYLCHSRTDIK 7 DR HF V+ W++ H R ++ Sbjct: 163 DRRYRHFTVVGXXXXWWVSHERESLR 188 >SB_43688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 27.5 bits (58), Expect = 3.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 154 SNDSPPFNNADPVMQLYNSVIPSVN 228 S D PPF++ D + S IPS+N Sbjct: 421 SGDGPPFSSDDTSQEANGSSIPSIN 445 >SB_19418| Best HMM Match : Mucin (HMM E-Value=0.024) Length = 1213 Score = 27.1 bits (57), Expect = 4.3 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +1 Query: 49 RIDDDKMILITVVLSALVTRVSLTPLCNNTAVSITSNDSPPFNNAD 186 +ID+ ++IL+T A S +C ++A + T+N +P N + Sbjct: 815 KIDNMEVILLTPTSMAASMATSSKKVCPSSAPTTTTNPTPSVTNGN 860 >SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 27.1 bits (57), Expect = 4.3 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 55 DDDKMILITVVLSALVTRVSL-TPLCNNTAVSITSNDSP 168 DDD L ++ A + ++ TPLC + + +I DSP Sbjct: 290 DDDPASLANIINEAFLAPMAFFTPLCADASPTIPPTDSP 328 >SB_37009| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 26.6 bits (56), Expect = 5.7 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 130 NNTAVSITSNDSPPFNNADPVMQ 198 N+ AV T +PP NN DP+ + Sbjct: 388 NDLAVLYTQKKNPPMNNRDPLSE 410 >SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) Length = 1178 Score = 26.6 bits (56), Expect = 5.7 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -3 Query: 63 VVIDSSSRWYLCHSRTDIKFK 1 +V+ ++++W +CH R D+ K Sbjct: 541 IVLPANAQWRVCHPRADVHLK 561 >SB_14565| Best HMM Match : YGGT (HMM E-Value=0.11) Length = 357 Score = 26.6 bits (56), Expect = 5.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 186 VSIIKWRRVIGGNRDCSVVT*RCERNAG 103 +S++KW G DC+VV R E N G Sbjct: 1 MSLMKWMLDYGDKSDCNVVVVRKEDNDG 28 >SB_6204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 26.6 bits (56), Expect = 5.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 49 RIDDDKMILITVVLSALVTRVSLTPLCNNTAVS 147 RI+DD + I L+A T + LCNN S Sbjct: 179 RIEDDGAVAIAEALAAYNTNLIKLVLCNNNIAS 211 >SB_3502| Best HMM Match : zf-DBF (HMM E-Value=4.9) Length = 476 Score = 25.8 bits (54), Expect = 9.9 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 106 RVSLTPLCNNTAVSITSNDSPPFNNADPVMQLYNSVIPSVNYKGC 240 R SL +CN T S DS P ++ +L + +P KGC Sbjct: 4 RKSLGNVCNYTDRSPEDYDSSPLPSSAVSTELNDPFVPRKMSKGC 48 >SB_12185| Best HMM Match : AAA_5 (HMM E-Value=0.002) Length = 3616 Score = 25.8 bits (54), Expect = 9.9 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 186 VSIIKWRRVIGGNRDCSVVT*RCERNAG 103 +S++KW G DC VV R E N G Sbjct: 2368 MSLMKWMLDYGDKSDCHVVVVRKEDNDG 2395 >SB_8007| Best HMM Match : HisKA_3 (HMM E-Value=4.2) Length = 178 Score = 25.8 bits (54), Expect = 9.9 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 115 LTPLCN-NTAVSITSNDSPPFNNADPVMQL 201 L PL ++ V ++SN PP N DP+ +L Sbjct: 102 LLPLSQTDSRVPLSSNTVPPAENTDPITRL 131 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,566,742 Number of Sequences: 59808 Number of extensions: 142939 Number of successful extensions: 424 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 422 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 535585339 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -