BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B05 (507 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 21 5.6 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 21 5.6 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 5.6 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 5.6 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 5.6 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 21 5.6 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 21 7.3 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 9.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.7 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 21.4 bits (43), Expect = 5.6 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +1 Query: 304 NIFN*QIWKRRSTLSKRTKEESSHRXQVTLRQW 402 NI + W R ++ T + HR +V L W Sbjct: 40 NIKRKRSWSRPRESAQTTSKAGIHRKKVLLLVW 72 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.4 bits (43), Expect = 5.6 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -2 Query: 146 PCIPNGPVDLRPFYIESHICKTSNFIN 66 P P+ P+ + PF IC F++ Sbjct: 447 PTTPHSPLLVAPFGAGRRICPGKRFVD 473 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 5.6 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -1 Query: 420 NAGYKIPLSK 391 N GYKIP++K Sbjct: 154 NVGYKIPITK 163 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 5.6 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -1 Query: 420 NAGYKIPLSK 391 N GYKIP++K Sbjct: 154 NVGYKIPITK 163 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 5.6 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -1 Query: 420 NAGYKIPLSK 391 N GYKIP++K Sbjct: 154 NVGYKIPITK 163 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.4 bits (43), Expect = 5.6 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +1 Query: 304 NIFN*QIWKRRSTLSKRTKEESSHRXQVTLRQW 402 NI + W R ++ T + HR +V L W Sbjct: 161 NIKRKRSWSRPREPAQTTSKAGIHRKKVLLSVW 193 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.0 bits (42), Expect = 7.3 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +1 Query: 304 NIFN*QIWKRRSTLSKRTKEESSHRXQVTLRQW 402 NI + W R ++ T + HR +V L W Sbjct: 39 NIKRKRWWSRPREPAQTTSKAGIHRKKVLLSVW 71 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 20.6 bits (41), Expect = 9.7 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -1 Query: 162 LRAAITMYTERTGG 121 +R+AIT++ +RT G Sbjct: 166 IRSAITIFPQRTDG 179 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.6 bits (41), Expect = 9.7 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 407 LYPAFRENDDPI 442 LYPAF + DP+ Sbjct: 71 LYPAFSSSCDPV 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,752 Number of Sequences: 438 Number of extensions: 2725 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13986774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -