BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B02 (543 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0943 - 26191798-26192244,26192802-26192966,26193515-261936... 27 7.3 >06_03_0943 - 26191798-26192244,26192802-26192966,26193515-26193668, 26194153-26194346,26194494-26194695,26194899-26195103, 26195672-26195843 Length = 512 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -1 Query: 375 IIFFYFTYFIPLKCKYIYTSLFLN-LCLTADCRH 277 I+ Y+T+FIP KY+ + L+ N LC ++ H Sbjct: 375 ILVAYWTHFIPNTEKYLKSLLYSNILCTSSSYNH 408 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,817,202 Number of Sequences: 37544 Number of extensions: 205485 Number of successful extensions: 335 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 335 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1210221432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -