BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B02 (543 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC110541-1|AAI10542.1| 409|Homo sapiens SLC4A11 protein protein. 32 1.5 BC110540-1|AAI10541.1| 891|Homo sapiens solute carrier family 4... 32 1.5 AL109976-2|CAB90170.4| 918|Homo sapiens solute carrier family 4... 32 1.5 AL109976-1|CAD55941.1| 891|Homo sapiens solute carrier family 4... 32 1.5 AK075303-1|BAC11536.1| 633|Homo sapiens protein ( Homo sapiens ... 32 1.5 AF336127-1|AAK16734.1| 891|Homo sapiens bicarbonate transporter... 32 1.5 >BC110541-1|AAI10542.1| 409|Homo sapiens SLC4A11 protein protein. Length = 409 Score = 31.9 bits (69), Expect = 1.5 Identities = 20/66 (30%), Positives = 34/66 (51%) Frame = -3 Query: 391 LLLICHYIFLFHVLYSLKM*IYIHKFVSESVSNC*LPTSLYVSIMQTGSGKNTLVMSFHI 212 LL++ ++L + LY K Y+H V E +S+C LP ++ + + G + MS Sbjct: 96 LLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFR 155 Query: 211 YAGNPN 194 Y NP+ Sbjct: 156 Y--NPS 159 >BC110540-1|AAI10541.1| 891|Homo sapiens solute carrier family 4, sodium borate transporter, member 11 protein. Length = 891 Score = 31.9 bits (69), Expect = 1.5 Identities = 20/66 (30%), Positives = 34/66 (51%) Frame = -3 Query: 391 LLLICHYIFLFHVLYSLKM*IYIHKFVSESVSNC*LPTSLYVSIMQTGSGKNTLVMSFHI 212 LL++ ++L + LY K Y+H V E +S+C LP ++ + + G + MS Sbjct: 578 LLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFR 637 Query: 211 YAGNPN 194 Y NP+ Sbjct: 638 Y--NPS 641 >AL109976-2|CAB90170.4| 918|Homo sapiens solute carrier family 4, sodium bicarbonate transporter-like, member 11 protein. Length = 918 Score = 31.9 bits (69), Expect = 1.5 Identities = 20/66 (30%), Positives = 34/66 (51%) Frame = -3 Query: 391 LLLICHYIFLFHVLYSLKM*IYIHKFVSESVSNC*LPTSLYVSIMQTGSGKNTLVMSFHI 212 LL++ ++L + LY K Y+H V E +S+C LP ++ + + G + MS Sbjct: 605 LLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFR 664 Query: 211 YAGNPN 194 Y NP+ Sbjct: 665 Y--NPS 668 >AL109976-1|CAD55941.1| 891|Homo sapiens solute carrier family 4, sodium bicarbonate transporter-like, member 11 protein. Length = 891 Score = 31.9 bits (69), Expect = 1.5 Identities = 20/66 (30%), Positives = 34/66 (51%) Frame = -3 Query: 391 LLLICHYIFLFHVLYSLKM*IYIHKFVSESVSNC*LPTSLYVSIMQTGSGKNTLVMSFHI 212 LL++ ++L + LY K Y+H V E +S+C LP ++ + + G + MS Sbjct: 578 LLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFR 637 Query: 211 YAGNPN 194 Y NP+ Sbjct: 638 Y--NPS 641 >AK075303-1|BAC11536.1| 633|Homo sapiens protein ( Homo sapiens cDNA FLJ90822 fis, clone Y79AA1001426, weakly similar to ANION EXCHANGE PROTEIN 3. ). Length = 633 Score = 31.9 bits (69), Expect = 1.5 Identities = 20/66 (30%), Positives = 34/66 (51%) Frame = -3 Query: 391 LLLICHYIFLFHVLYSLKM*IYIHKFVSESVSNC*LPTSLYVSIMQTGSGKNTLVMSFHI 212 LL++ ++L + LY K Y+H V E +S+C LP ++ + + G + MS Sbjct: 320 LLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFR 379 Query: 211 YAGNPN 194 Y NP+ Sbjct: 380 Y--NPS 383 >AF336127-1|AAK16734.1| 891|Homo sapiens bicarbonate transporter-related protein BTR1 protein. Length = 891 Score = 31.9 bits (69), Expect = 1.5 Identities = 20/66 (30%), Positives = 34/66 (51%) Frame = -3 Query: 391 LLLICHYIFLFHVLYSLKM*IYIHKFVSESVSNC*LPTSLYVSIMQTGSGKNTLVMSFHI 212 LL++ ++L + LY K Y+H V E +S+C LP ++ + + G + MS Sbjct: 578 LLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFR 637 Query: 211 YAGNPN 194 Y NP+ Sbjct: 638 Y--NPS 641 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,380,067 Number of Sequences: 237096 Number of extensions: 1283460 Number of successful extensions: 1474 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1474 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5308067764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -