BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_B02 (543 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46343-3|CAA86459.1| 316|Caenorhabditis elegans Hypothetical pr... 27 8.7 AC006682-2|AAF39957.1| 370|Caenorhabditis elegans Hypothetical ... 27 8.7 >Z46343-3|CAA86459.1| 316|Caenorhabditis elegans Hypothetical protein T23F11.4 protein. Length = 316 Score = 27.1 bits (57), Expect = 8.7 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = +2 Query: 23 IISIQKGYFTLNYLLYFITTK*ITFSETIQ 112 +I+I G TLN L+ F+T K ITFS T Q Sbjct: 4 VINIDPGS-TLNELMAFMTQKTITFSVTDQ 32 >AC006682-2|AAF39957.1| 370|Caenorhabditis elegans Hypothetical protein R193.3 protein. Length = 370 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = -3 Query: 313 VSESVSNC*LPTSLYVSIMQTGSGKNTLVMSFHIYAGNPNII 188 V ++N +++ S + G+ KNT +M+ HI AGN ++I Sbjct: 153 VGNELANSAFEKNIFCSQLLIGN-KNTTMMTDHIVAGNLSVI 193 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,534,315 Number of Sequences: 27780 Number of extensions: 230136 Number of successful extensions: 478 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 478 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1091917214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -