BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_A20 (351 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25657| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) 42 1e-04 SB_28916| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 6e-04 SB_55143| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) 36 0.009 SB_38742| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.028 SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) 28 1.9 SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.9 SB_52654| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 27 4.3 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 27 5.7 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 27 5.7 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 27 5.7 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 26 7.5 SB_32905| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.5 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 26 7.5 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 26 7.5 SB_29942| Best HMM Match : NIF3 (HMM E-Value=9.7e-16) 26 9.9 SB_10768| Best HMM Match : Collagen (HMM E-Value=1.5) 26 9.9 SB_30955| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 >SB_25657| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) Length = 829 Score = 42.3 bits (95), Expect = 1e-04 Identities = 25/75 (33%), Positives = 37/75 (49%) Frame = +1 Query: 124 CYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHAN 303 CYY + S R P D++P L CTH+L+ A + T+K+ EN H Sbjct: 25 CYYTNWSQYRPKGGTFWPEDIDPFL--CTHILFSFAKVNQTTHKLDIYEEN-----DHEL 77 Query: 304 YRAITNLKRQFPQLR 348 Y+ I LK+ P+L+ Sbjct: 78 YQRINALKKINPKLK 92 Score = 37.9 bits (84), Expect = 0.002 Identities = 23/76 (30%), Positives = 38/76 (50%) Frame = +1 Query: 121 LCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHA 300 +CYY + S R P D++P L CTH+++ + + T+ M +N D D Sbjct: 409 VCYYTNWSQYRPKGGTFWPEDIDPHL--CTHVIHSFSKVNLTTHVMEKYEKN-DFDL--- 462 Query: 301 NYRAITNLKRQFPQLR 348 Y+ I LK+ P+L+ Sbjct: 463 -YKRINALKKINPKLK 477 >SB_28916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 807 Score = 39.9 bits (89), Expect = 6e-04 Identities = 24/76 (31%), Positives = 39/76 (51%) Frame = +1 Query: 121 LCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRAHA 300 +CY+ + + R + LP D++P L CTH++Y A I T K+ + N D Sbjct: 401 VCYFTNWAQYRPDPVKFLPKDIDPLL--CTHIVYAFAKIDPATNKIGTYEWNDD-----R 453 Query: 301 NYRAITNLKRQFPQLR 348 Y+ I +LK + P L+ Sbjct: 454 LYKEINDLKLKNPSLK 469 >SB_55143| Best HMM Match : Glyco_hydro_18 (HMM E-Value=0) Length = 270 Score = 35.9 bits (79), Expect = 0.009 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 1/77 (1%) Frame = +1 Query: 121 LCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGI-QADTYKMVSLNENLDIDRAH 297 +CY+ + S R+ +A+ P D+ PA CTHL+Y A I Q + M N+ D+ + Sbjct: 22 VCYHTNWSQYRQGRAKFWPEDI-PA-DLCTHLMYSFAKINQKNELAMYEWND----DKLY 75 Query: 298 ANYRAITNLKRQFPQLR 348 + A LK++ P+L+ Sbjct: 76 PRFNA---LKQKNPELK 89 >SB_38742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 34.3 bits (75), Expect = 0.028 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +1 Query: 121 LCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNEN 276 +CYY + + R A+ P +++P+L CTH++Y A + AD K+ N Sbjct: 25 VCYYTNWAQYR-GLAKYTPDNIDPSL--CTHIVYAFAKMNADNSKLAMFEWN 73 >SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) Length = 769 Score = 28.3 bits (60), Expect = 1.9 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +2 Query: 47 PSPGYWR*RLRLPTTQHHLVAKAKSSATMTARAISENLKHVCCLRTW 187 P P R R PT H K + T T R ++ +KHV +RT+ Sbjct: 316 PEPTDKRRRDEPPTDIHERRRYRKVTKTKTIRTVTTTVKHVVTVRTY 362 >SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1670 Score = 28.3 bits (60), Expect = 1.9 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +2 Query: 47 PSPGYWR*RLRLPTTQHHLVAKAKSSATMTARAISENLKHVCCLRTW 187 P P R R PT H K + T T R ++ +KHV +RT+ Sbjct: 983 PEPTDKRRRDEPPTDIHERRRYRKVTKTKTIRTVTTTVKHVVTVRTY 1029 >SB_52654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.1 bits (57), Expect = 4.3 Identities = 9/33 (27%), Positives = 21/33 (63%) Frame = +2 Query: 101 LVAKAKSSATMTARAISENLKHVCCLRTWSLLF 199 LVA+ K++ TAR + + +H+ + W++++ Sbjct: 65 LVARCKNALIQTARTVVKRHRHMIAQQRWTVVY 97 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 27.1 bits (57), Expect = 4.3 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 266 SETILYVSAWMPADLYSRWVQNERAGSKSVGSI 168 + T++ +AW D Y W+Q + G+ V S+ Sbjct: 398 ASTVIIDTAWCAGDSYDCWLQVDLGGTHCVTSV 430 >SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) Length = 362 Score = 26.6 bits (56), Expect = 5.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 233 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 343 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 230 ANNLYSVDYYVKKVVWDLMGEVLHYKHQQGTKDSWLN 266 >SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) Length = 279 Score = 26.6 bits (56), Expect = 5.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 233 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 343 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 147 ANNLYSVDYYVKKVVWDLMGEVLHYKHQQGTKDSWLN 183 >SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) Length = 532 Score = 26.6 bits (56), Expect = 5.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 233 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 343 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 400 ANNLYSVDYYVKKVVWDLMGEVLHYKHQQGTKDSWLN 436 >SB_45113| Best HMM Match : CemA (HMM E-Value=6) Length = 363 Score = 26.2 bits (55), Expect = 7.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 233 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 343 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 230 ANNLHGVDYYVKKVVWDLMGEVLEYKHQQGTKDSWLN 266 >SB_32905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 26.2 bits (55), Expect = 7.5 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +2 Query: 101 LVAKAKSSATMTARAISENLKHVCCLRTWSLLFRSAPICCTNLP 232 L+ KA ++T T S+ V CLR + L R+ P C N+P Sbjct: 110 LMGKAGRASTPTCARRSD----VHCLREYVHLMRTNPDLCVNIP 149 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 26.2 bits (55), Expect = 7.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 233 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 343 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 229 ANNLYGVDYYVKKVVWDLMGEVLEYKHQQGTKDSWLN 265 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 26.2 bits (55), Expect = 7.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 233 ASKLTHIKWFHSMRIWTLIGRTLIIERSQT*KDSFLN 343 A+ L + ++ +W L+G L + Q KDS+LN Sbjct: 146 ANNLYGVDYYVKKVVWDLMGEVLEYKHQQGTKDSWLN 182 >SB_29942| Best HMM Match : NIF3 (HMM E-Value=9.7e-16) Length = 200 Score = 25.8 bits (54), Expect = 9.9 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -2 Query: 296 CARSMSKFSLSETILYVSAWMPADLYSRW 210 C S+ + L E + + +W P L +W Sbjct: 20 CLSSVHQMDLKEVVSNLESWAPTSLAEKW 48 >SB_10768| Best HMM Match : Collagen (HMM E-Value=1.5) Length = 274 Score = 25.8 bits (54), Expect = 9.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 174 AYGLGACSFVLHPSAVQICR 233 A+ LG+CSFV+ PS R Sbjct: 78 AFSLGSCSFVVEPSKESTAR 97 >SB_30955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 971 Score = 25.8 bits (54), Expect = 9.9 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +1 Query: 121 LCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNE 273 + Y+DS S++ A +L E +FC L++ G TY +S+ E Sbjct: 920 IAYFDSHSHMANHGALVLLCATENMRTFC-EALWRYEGFNKPTYGNLSMVE 969 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,871,493 Number of Sequences: 59808 Number of extensions: 178241 Number of successful extensions: 513 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 535585339 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -