BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_A19 (592 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63410.1 68418.m07960 leucine-rich repeat transmembrane prote... 32 0.33 At5g39460.1 68418.m04779 F-box family protein contains Pfam:PF00... 31 0.43 At5g39480.1 68418.m04781 F-box family protein contains Pfam:PF00... 31 0.57 At4g24180.1 68417.m03470 pathogenesis-related thaumatin family p... 31 0.76 At3g62160.1 68416.m06984 transferase family protein low similari... 29 2.3 At5g13700.1 68418.m01595 polyamine oxidase, putative similar to ... 28 5.4 At3g57300.1 68416.m06378 transcriptional activator, putative sim... 27 9.4 At1g68180.1 68414.m07788 zinc finger (C3HC4-type RING finger) fa... 27 9.4 >At5g63410.1 68418.m07960 leucine-rich repeat transmembrane protein kinase, putative contains similarity to receptor-like protein kinase Length = 680 Score = 31.9 bits (69), Expect = 0.33 Identities = 22/87 (25%), Positives = 41/87 (47%), Gaps = 5/87 (5%) Frame = +1 Query: 295 YANYSNTFLYNNEEQRLTYLTEDIGFNSYYYYFHSHLPFWWSSERY---GNLKHRR--GE 459 Y + SN FL+ + +L+ + + F + +F+ LP W+ S Y + K + GE Sbjct: 145 YLDLSNNFLFGSVPPKLSTMVKLETFRFDHNFFNGTLPSWFDSYWYLKVLSFKSNKLSGE 204 Query: 460 IYYNFYQQLTTRYYFERLTNGLGSIPE 540 ++ + T Y R + GS+P+ Sbjct: 205 LHSSLLSLSTIEYIDLRANSLSGSLPD 231 >At5g39460.1 68418.m04779 F-box family protein contains Pfam:PF00646 F-box domain ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 571 Score = 31.5 bits (68), Expect = 0.43 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +2 Query: 239 TMQRLLIMEL*KRKSSMCITPTIPTLSFTIMK 334 T+QR+ + E+ K+ C++P +PT +FT K Sbjct: 522 TLQRINLGEILKKSLGSCVSPLLPTKNFTYTK 553 >At5g39480.1 68418.m04781 F-box family protein contains Pfam:PF00646 F-box domain ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 568 Score = 31.1 bits (67), Expect = 0.57 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +2 Query: 200 LRFIALKCKTVFFTMQRLLIMEL*KRKSSMCITPTIPTLSFTIMK 334 L F+ + K V T+QRL + E+ K+ C+ P P+ +FT M+ Sbjct: 507 LAFVWKETKVVI-TLQRLNLTEILKKGLGSCVPPLPPSKNFTYMR 550 >At4g24180.1 68417.m03470 pathogenesis-related thaumatin family protein similar to SP|P28493 Pathogenesis-related protein 5 precursor (PR-5) {Arabidopsis thaliana}; contains Pfam profile PF00314: Thaumatin family Length = 255 Score = 30.7 bits (66), Expect = 0.76 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -2 Query: 579 GIVTSLNRRVPREFRYGTQAVCKT 508 G VT LN++ P E R+G+ + CK+ Sbjct: 165 GCVTDLNQKCPTELRFGSGSACKS 188 >At3g62160.1 68416.m06984 transferase family protein low similarity to Taxus cuspidata transferases: 10-deacetylbaccatin III-10-O-acetyl transferase GI:6746554, taxadienol acetyl transferase GI:6978038, 2-debenzoyl-7,13-diacetylbaccatin III-2-O-benzoyl transferase GI:11559716; contains Pfam profile PF02458 transferase family Length = 428 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -2 Query: 576 IVTSLNRRVPREFRYGTQAVCKTLEVITCC 487 I + L R REFR T +C EVI C Sbjct: 224 IPSDLIERFKREFRASTGEICSAFEVIAAC 253 >At5g13700.1 68418.m01595 polyamine oxidase, putative similar to SP|O64411 Polyamine oxidase precursor (EC 1.5.3.11) from Zea mays Length = 472 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +1 Query: 157 YEVYPQFFVNMDTLLKIYRTKMQDGILHDAKAINYGIVKEEEQYVYYANY 306 Y++ +F V + YR K+ + ++ N +VK E+ VY ANY Sbjct: 188 YKMAEEFLVTSHGNILDYRLKLNQVVREVQQSRNGVVVKTEDGSVYEANY 237 >At3g57300.1 68416.m06378 transcriptional activator, putative similar to transcriptional activator SRCAP [Homo sapiens] GI:5106572; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1507 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 61 ARVHLNEGQFLYAYYIAVIQRNDTHGFV 144 AR L+EG L +Y+ ++++ DT+ V Sbjct: 295 ARTILSEGGVLQVHYVKILEKGDTYEIV 322 >At1g68180.1 68414.m07788 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 248 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -1 Query: 352 GRSTSVLHYCKGKCWNSWRNTHTALPLLQF 263 G+ LH C SW N H P+ +F Sbjct: 151 GKELKCLHLYHSSCIVSWLNIHNTCPICRF 180 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,480,661 Number of Sequences: 28952 Number of extensions: 250849 Number of successful extensions: 706 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -