BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_A17 (445 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly... 29 1.4 At5g40200.1 68418.m04878 DegP protease, putative contains simila... 29 1.9 At4g22320.1 68417.m03227 expressed protein 28 3.3 At4g01440.1 68417.m00185 nodulin MtN21 family protein similar to... 28 3.3 At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase fa... 28 3.3 At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CH... 27 4.3 At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CH... 27 4.3 At5g27230.1 68418.m03248 expressed protein ; expression support... 27 5.7 At5g34900.1 68418.m04114 Ulp1 protease family protein contains P... 27 7.5 At5g07940.1 68418.m00920 expressed protein 27 7.5 At4g34200.1 68417.m04854 D-3-phosphoglycerate dehydrogenase, put... 27 7.5 At5g24450.1 68418.m02882 transcription factor-related low simila... 26 10.0 At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related si... 26 10.0 At1g79670.2 68414.m09292 wall-associated kinase, putative simila... 26 10.0 At1g79670.1 68414.m09291 wall-associated kinase, putative simila... 26 10.0 At1g17500.1 68414.m02150 haloacid dehalogenase-like hydrolase fa... 26 10.0 >At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly identical to GI:9957293; contains Pfam profile: PF01397 terpene synthase family Length = 591 Score = 29.1 bits (62), Expect = 1.4 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 2/108 (1%) Frame = +1 Query: 124 ERQKKVLSLFQD--VDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRIGYLPK 297 E+ +K+L+ Q +DQ+ D+ K+G Y EA IDN ++ + Sbjct: 82 EKVRKMLNDEQKTYLDQLEFIDDLQKLGVSYHFEAEIDNILTSSYKKDRTNIQESDLHAT 141 Query: 298 YYEFSIFYQKLREEAIALFHLFYYAKDFETFYKSAAFARVHLNEGQFL 441 EF +F Q + +F +F ++ F + + + L E +L Sbjct: 142 ALEFRLFRQHGFNVSEDVFDVF--MENCGKFDRDDIYGLISLYEASYL 187 >At5g40200.1 68418.m04878 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 592 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 172 NVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRI 282 N +DEY K DYD +D T K+A + L + I Sbjct: 542 NCEDEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCI 578 >At4g22320.1 68417.m03227 expressed protein Length = 238 Score = 27.9 bits (59), Expect = 3.3 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +1 Query: 100 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEE 261 K V +E QKK ++ ++ D++ DD KI +D VE D K VEE Sbjct: 115 KYVPIAVLEEQKKEITEIEEDDKIEEDD---KIDEDNKVEQE-DKVDEDKTVEE 164 >At4g01440.1 68417.m00185 nodulin MtN21 family protein similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula] Length = 365 Score = 27.9 bits (59), Expect = 3.3 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = +1 Query: 49 ALVQSSVVSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIG 201 ++V S VV Y F V + E +KK+ F + DQ DDE YK G Sbjct: 306 SVVGSGVVIFGLYIFLLGKVRLMKEECEKKLPCRFNEDDQEEDDDEQYKKG 356 >At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from Homo sapiens [SP|Q9Y2Q0, SP|O43520]; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1228 Score = 27.9 bits (59), Expect = 3.3 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = -2 Query: 411 SESGTLVEG-FKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQFQ 265 S SG ++E +KV +++E K + + E+G++++L K DS+ F+ Sbjct: 595 SGSGQIIEREYKVLNLLEFTSKRKRMTVIVRDEEGQILLLCKGADSIIFE 644 >At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 742 Score = 27.5 bits (58), Expect = 4.3 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -2 Query: 306 LIVLGKITDSVQFQEFFNSFLIGVVI 229 ++V G ITD++ F +F++GV+I Sbjct: 204 VLVCGFITDAIGIHSMFGAFVVGVLI 229 >At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 810 Score = 27.5 bits (58), Expect = 4.3 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -2 Query: 306 LIVLGKITDSVQFQEFFNSFLIGVVI 229 ++V G ITD++ F +F++GV+I Sbjct: 272 VLVCGFITDAIGIHSMFGAFVVGVLI 297 >At5g27230.1 68418.m03248 expressed protein ; expression supported by MPSS Length = 948 Score = 27.1 bits (57), Expect = 5.7 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +1 Query: 106 VDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLK 270 V A+ +E+++K L L + + E+ K KD+D+E + K+ VE+ K Sbjct: 69 VKALELEKKEKELCLIDESMKAK-QSEFEKKEKDFDLEQKAEVEKRKREVEQLEK 122 >At5g34900.1 68418.m04114 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At1g32840, At4g04010, At2g06430, At2g15140, At2g04980, At2g14130, At3g44500, At2g15190, At3g47260, At3g29210, At2g02210, At3g32900 Length = 767 Score = 26.6 bits (56), Expect = 7.5 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +1 Query: 136 KVLSLFQDVDQVNVDDEYYKIGKDYDVEANI-DNYTNKKAVEEFLKLYRIGYLPKYYEFS 312 K+++L DV ++ V+ IG D ++ + D +TN ++ L+L ++GY K E++ Sbjct: 287 KIVNLVNDVYEIEVNTI---IGNPEDFKSLVPDFHTNDTEFQQVLELVKMGYRLKKTEWN 343 >At5g07940.1 68418.m00920 expressed protein Length = 1526 Score = 26.6 bits (56), Expect = 7.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 81 NVSLQDKRCRRSVCGAPEKGFIPFP 155 N+S QDK C+ G EK F+ P Sbjct: 393 NISAQDKFCQMEDSGPAEKSFMKVP 417 >At4g34200.1 68417.m04854 D-3-phosphoglycerate dehydrogenase, putative / 3-PGDH, putative similar to phosphoglycerate dehydrogenase, Arabidopsis thaliana, SP:O04130 Length = 603 Score = 26.6 bits (56), Expect = 7.5 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -2 Query: 372 SIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQFQEFFNSFLIGVVID 226 +I Q+ S F L E GE+ V GK+ D V SF + V ++ Sbjct: 480 TITVQLSNVESKFASSLSESGEVKVEGKVKDGVPHLTKVGSFEVDVTLE 528 >At5g24450.1 68418.m02882 transcription factor-related low similarity to transcription factor IIIC63 [Homo sapiens] GI:5281316 Length = 545 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +1 Query: 73 SPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNY 237 S + + TKD+ ++K + D D ++DDEY + D D+ + Y Sbjct: 434 SQRNHQETTKDMKKCKNTNKEKDDDVNADEDSEDLDDEYEEAANDDDISISSHGY 488 >At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related similar to ubiquitin-conjugating enzyme (GI:3319990) [Mus musculus]; similar to Baculoviral IAP repeat-containing protein 6 (Ubiquitin-conjugating BIR-domain enzyme apollon) (Swiss-Prot:Q9NR09) [Homo sapiens]; Length = 609 Score = 26.2 bits (55), Expect = 10.0 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 145 SLFQDVDQVNVDDEYYKIGKDYDVEANIDNYT 240 SL + DDE Y D+++EA DNY+ Sbjct: 94 SLLDPESLIYEDDENYSEQYDFEMEAEPDNYS 125 >At1g79670.2 68414.m09292 wall-associated kinase, putative similar to wall-associated kinase 4 GI:3355308 from [Arabidopsis thaliana]; isoform contains non-consensus AT-acceptor splice site. Length = 714 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +1 Query: 34 LAGLIALVQSSVVSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEY 189 +AG +A + S+ +P YH K + + E+ + +S F +NVD + Sbjct: 490 IAGALAYLHSAASTP-VYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTH 540 >At1g79670.1 68414.m09291 wall-associated kinase, putative similar to wall-associated kinase 4 GI:3355308 from [Arabidopsis thaliana]; isoform contains non-consensus AT-acceptor splice site. Length = 751 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +1 Query: 34 LAGLIALVQSSVVSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEY 189 +AG +A + S+ +P YH K + + E+ + +S F +NVD + Sbjct: 527 IAGALAYLHSAASTP-VYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTH 577 >At1g17500.1 68414.m02150 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from Homo sapiens [SP|O43520], Mus musculus [SP|P70704]; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1218 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 411 SESGTLVEG-FKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQFQ 265 S SG +E +KV ++++ K + + E+G++++L K DS+ F+ Sbjct: 584 SHSGQTIEREYKVLNLLDFTSKRKRMSVVVRDEEGQILLLCKGADSIIFE 633 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,921,106 Number of Sequences: 28952 Number of extensions: 168681 Number of successful extensions: 462 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 462 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 712739520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -