BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_A14 (545 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B... 26 0.93 AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B... 26 0.93 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 1.2 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 25 1.6 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 25 2.2 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 25 2.2 CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein ... 24 2.8 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 24 3.8 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 23 5.0 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 23 5.0 AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding pr... 23 6.6 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 23 6.6 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 23 6.6 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 23 6.6 AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-tran... 23 8.7 AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-tran... 23 8.7 >AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B precursor protein. Length = 423 Score = 25.8 bits (54), Expect = 0.93 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +3 Query: 15 FLTVPIGVPISNNYVYLLDENMRCVREGEPGEVCVAGFNLARGY 146 ++ VP+ P + YVY ++N + PG V G +L R + Sbjct: 220 YVIVPVANP--DGYVYTHEQNRLWRKNRSPGNVLCYGVDLNRNF 261 >AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B protein. Length = 423 Score = 25.8 bits (54), Expect = 0.93 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +3 Query: 15 FLTVPIGVPISNNYVYLLDENMRCVREGEPGEVCVAGFNLARGY 146 ++ VP+ P + YVY ++N + PG V G +L R + Sbjct: 220 YVIVPVANP--DGYVYTHEQNRLWRKNRSPGNVLCYGVDLNRNF 261 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.4 bits (53), Expect = 1.2 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +3 Query: 306 VDLQEVDHAVSTIPCVDNCVVLCYGVESSNPEILAFVTINPEARMSAK 449 ++L+ + AVST+ V N ++ GV+ S PE T R AK Sbjct: 923 IELKSREGAVSTLGLVWNPILDTLGVKISEPETCEIYTKRSIIRTIAK 970 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = -1 Query: 287 DLRVSTTRIQDHAFIQDAEITSAIQFGKIRVSVMRVMDEAMRIFTAHIS 141 DLR+ + QDH I A + + +I V M+ + + +F ++ Sbjct: 270 DLRMVLNQTQDHRAIVLASVAKELFSWRIMVKKMKAIYHTLNLFNMDVT 318 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 69 DENMRCVREGEPGEVCVAGFNL 134 DE R REGEP +C F + Sbjct: 149 DECARACREGEPPRICYYHFTV 170 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 69 DENMRCVREGEPGEVCVAGFNL 134 DE R REGEP +C F + Sbjct: 149 DECARACREGEPPRICYYHFTV 170 >CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein protein. Length = 277 Score = 24.2 bits (50), Expect = 2.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 99 HLPERIAYSHPEGKRNCSISVHQ 31 HL E+I YS +G C++ + Q Sbjct: 64 HLGEQITYSKTQGSVECTLVIPQ 86 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.8 bits (49), Expect = 3.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 105 RVHLPERIAYSHPEGKRNCSISVHQ*VL 22 R+H R+A E + N IS+HQ VL Sbjct: 245 RIHCLARVAQDRAEKELNEIISMHQRVL 272 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.4 bits (48), Expect = 5.0 Identities = 18/57 (31%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +3 Query: 87 VREGEPGEVCVAGFNLARGYVRGKDPHRFIHNPHNTHPNFAKLYR-TGDFGILDKGV 254 VREG + FN G+ R +PH N H+ P L D LD+ V Sbjct: 490 VREGSVYFQRSSTFNHHNGHQRNLNPHIKFSNSHSNLPEEISLMSLEKDLRSLDENV 546 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.4 bits (48), Expect = 5.0 Identities = 18/57 (31%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +3 Query: 87 VREGEPGEVCVAGFNLARGYVRGKDPHRFIHNPHNTHPNFAKLYR-TGDFGILDKGV 254 VREG + FN G+ R +PH N H+ P L D LD+ V Sbjct: 491 VREGSVYFQRSSTFNHHNGHQRNLNPHIKFSNSHSNLPEEISLMSLEKDLRSLDENV 547 >AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding protein AgamOBP38 protein. Length = 336 Score = 23.0 bits (47), Expect = 6.6 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 303 RVDLQEVDHAVSTIPCVDNCVVLCYGVES 389 R L D A + C NC++ C G+ + Sbjct: 50 RQSLYAYDSAAVPLNCGSNCLLRCIGLNA 78 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.0 bits (47), Expect = 6.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 147 VRGKDPHRFIHNPHNT 194 +RGKDPH ++N T Sbjct: 428 LRGKDPHVLVNNEWGT 443 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.0 bits (47), Expect = 6.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 147 VRGKDPHRFIHNPHNT 194 +RGKDPH ++N T Sbjct: 428 LRGKDPHVLVNNEWGT 443 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 23.0 bits (47), Expect = 6.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 147 VRGKDPHRFIHNPHNT 194 +RGKDPH ++N T Sbjct: 314 LRGKDPHVLVNNEWGT 329 >AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-transferase D1-3 protein. Length = 218 Score = 22.6 bits (46), Expect = 8.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 Query: 273 HDPHTRSRLYPG 238 HDP RLYPG Sbjct: 80 HDPALAERLYPG 91 >AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 22.6 bits (46), Expect = 8.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 Query: 273 HDPHTRSRLYPG 238 HDP RLYPG Sbjct: 80 HDPALAERLYPG 91 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 636,811 Number of Sequences: 2352 Number of extensions: 13719 Number of successful extensions: 35 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -