BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_A13 (379 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z29609-1|CAA82726.1| 98|Homo sapiens immunoglobulin heavy chai... 29 3.8 Z27511-1|CAA81831.1| 98|Homo sapiens Ig H-chain V-region (DP-8... 29 3.8 >Z29609-1|CAA82726.1| 98|Homo sapiens immunoglobulin heavy chain variable region (HC16-12) protein. Length = 98 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +2 Query: 227 VESAGRSNG*PKGLLSITKASNG--VRSWLLDSNGYTKTKELEWISTFSTS 373 VES GR P G L ++ A++G V SW + K LEW+S S+S Sbjct: 5 VES-GRGLAQPGGYLKLSGAASGFTVGSWYMSWIHQAPGKGLEWVSYISSS 54 >Z27511-1|CAA81831.1| 98|Homo sapiens Ig H-chain V-region (DP-84) protein. Length = 98 Score = 29.5 bits (63), Expect = 3.8 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +2 Query: 227 VESAGRSNG*PKGLLSITKASNG--VRSWLLDSNGYTKTKELEWISTFSTS 373 VES GR P G L ++ A++G V SW + K LEW+S S+S Sbjct: 5 VES-GRGLAQPGGYLKLSGAASGFTVGSWYMSWIHQAPGKGLEWVSYISSS 54 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,965,866 Number of Sequences: 237096 Number of extensions: 1057714 Number of successful extensions: 2138 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2138 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2536788584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -