BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_A07 (576 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87241-1|CAA60685.1| 4590|Homo sapiens homologue of Drosophila F... 36 0.14 AF109356-1|AAQ13504.1| 249|Homo sapiens MSTP002 protein. 29 8.9 >X87241-1|CAA60685.1| 4590|Homo sapiens homologue of Drosophila Fat protein protein. Length = 4590 Score = 35.5 bits (78), Expect = 0.14 Identities = 16/50 (32%), Positives = 31/50 (62%) Frame = -3 Query: 187 GESIIVVLRSQEDLDNGISGNIGLNVDGNTERLVVESWLTNLEVVWVTSL 38 G S ++ +R+ D D+G +G + ++D + V+ES+ N+E W+T+L Sbjct: 2826 GGSRVIQIRAS-DADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTL 2874 >AF109356-1|AAQ13504.1| 249|Homo sapiens MSTP002 protein. Length = 249 Score = 29.5 bits (63), Expect = 8.9 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 454 YENKELEWISTFSTSWQHQSIWHAFKTFRHIQ 359 Y N +W+ W Q +WHA T+ H Q Sbjct: 202 YSNLVYDWVKAGRPLWCCQHLWHASTTWTHPQ 233 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,745,918 Number of Sequences: 237096 Number of extensions: 1777314 Number of successful extensions: 11256 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11256 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5929224630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -