BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_A03 (433 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 23 1.6 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 22 2.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.6 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 6.6 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 20 8.8 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 20 8.8 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 22.6 bits (46), Expect = 1.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 41 NDYFFYSFIYSINISKFDSCTDLYN 115 N F + FI +S F+SCT L N Sbjct: 390 NFMFSFGFILLRFLSVFESCTRLNN 414 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.8 bits (44), Expect = 2.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 312 CVGLYNCEHITYMMLDKTR 368 C LYNC H T +++ +R Sbjct: 142 CQFLYNCFHSTLLLMILSR 160 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 6.6 Identities = 13/62 (20%), Positives = 26/62 (41%) Frame = -3 Query: 416 FRTVTNGLSNVIHCTLSGLI*HHISNMLTVVQTDTNSRLIVWSLTSV*NGTAHHRYIILI 237 F + +HC L G + + N + D N + W + +GT++ + ++ Sbjct: 1284 FAAYPGDCTRYLHC-LWGK--YEVFNCAPGLHWDNNKNICDWPEKATCDGTSNVNVVDIV 1340 Query: 236 TT 231 TT Sbjct: 1341 TT 1342 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 20.6 bits (41), Expect = 6.6 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 85 TDINRIYETVEKII 44 T++ R Y+ VEKI+ Sbjct: 65 TNLKRFYKVVEKIL 78 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 20.2 bits (40), Expect = 8.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 302 LIVWSLTSV*NGTAH 258 L+ WS TS+ N T H Sbjct: 26 LLDWSKTSLDNATEH 40 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 20.2 bits (40), Expect = 8.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 302 LIVWSLTSV*NGTAH 258 L+ WS TS+ N T H Sbjct: 26 LLDWSKTSLDNATEH 40 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,037 Number of Sequences: 336 Number of extensions: 2247 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9565283 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -