BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_A03 (433 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schiz... 26 2.2 SPAC56F8.11 |spc3||signal peptidase subunit Spc3 |Schizosaccharo... 26 2.8 SPBC1198.01 |||glutathione-dependent formaldehyde dehydrogenase ... 25 6.6 SPBC13G1.02 |||mannose-1-phosphate guanyltransferase |Schizosacc... 24 8.7 >SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 926 Score = 26.2 bits (55), Expect = 2.2 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +3 Query: 183 NKSRTAEDKKLLGDSQCGYENNIPMVCCPISNACKTPDD*PGI 311 ++S T+ D+ L S Y ++P++C ++ C TP D G+ Sbjct: 162 SQSYTSIDR--LNSSSSHYSKDVPLLCGSLTIDCPTPIDLRGM 202 >SPAC56F8.11 |spc3||signal peptidase subunit Spc3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 185 Score = 25.8 bits (54), Expect = 2.8 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = -1 Query: 151 YRDTQFPDSFLGVVQVCARIKF---TDINRIYETVEKIIILLLFIKYNS 14 YR +F +F V Q A++KF D++ +++ K +++ L Y++ Sbjct: 52 YRSARFYHAFRNVRQQYAQVKFNMDADLSELWDWNTKHVVVYLVASYST 100 >SPBC1198.01 |||glutathione-dependent formaldehyde dehydrogenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 423 Score = 24.6 bits (51), Expect = 6.6 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 1/79 (1%) Frame = +3 Query: 72 LLISVNLIRAQTCTTPRNESGNCVSLYDCEPL-LNLFRNKSRTAEDKKLLGDSQCGYENN 248 ++I+ +L Q R+E C + D + + +N + S KLLGD Sbjct: 119 VVIAFDLACGQCSFCKRHEYAACDTTNDSKLMDVNYGSHHSAIFGYTKLLGDVPGCQAEY 178 Query: 249 IPMVCCPISNACKTPDD*P 305 I + I N CK PDD P Sbjct: 179 IRVPFAEI-NCCKLPDDIP 196 >SPBC13G1.02 |||mannose-1-phosphate guanyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 414 Score = 24.2 bits (50), Expect = 8.7 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -2 Query: 177 INSVKAHNRIGTRNSLIHF*ELYRSVHESNLLIL 76 I ++ +N +GT L HF + H SN+ ++ Sbjct: 82 IKYLREYNCLGTGGGLYHFRDQILKGHTSNVFVM 115 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,790,409 Number of Sequences: 5004 Number of extensions: 35240 Number of successful extensions: 71 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 154067960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -