BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_A02 (502 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U02687-1|AAA18947.1| 993|Homo sapiens serine/threonine protein ... 30 5.2 BC126350-1|AAI26351.1| 993|Homo sapiens fms-related tyrosine ki... 30 5.2 BC036028-1|AAH36028.1| 596|Homo sapiens FLT3 protein protein. 30 5.2 AL591024-3|CAH70634.1| 996|Homo sapiens fms-related tyrosine ki... 30 5.2 AL445262-1|CAI17231.1| 996|Homo sapiens fms-related tyrosine ki... 30 5.2 AL356915-1|CAI12447.1| 996|Homo sapiens fms-related tyrosine ki... 30 5.2 >U02687-1|AAA18947.1| 993|Homo sapiens serine/threonine protein kinase protein. Length = 993 Score = 29.9 bits (64), Expect = 5.2 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 38 KSDYSIKAASVAQLYYGATVVLRSRVRSPGRVKCYWVF 151 +S ++ A+ ++ A++ L+ V +PG + C WVF Sbjct: 70 QSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVF 107 >BC126350-1|AAI26351.1| 993|Homo sapiens fms-related tyrosine kinase 3 protein. Length = 993 Score = 29.9 bits (64), Expect = 5.2 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 38 KSDYSIKAASVAQLYYGATVVLRSRVRSPGRVKCYWVF 151 +S ++ A+ ++ A++ L+ V +PG + C WVF Sbjct: 70 QSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVF 107 >BC036028-1|AAH36028.1| 596|Homo sapiens FLT3 protein protein. Length = 596 Score = 29.9 bits (64), Expect = 5.2 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 38 KSDYSIKAASVAQLYYGATVVLRSRVRSPGRVKCYWVF 151 +S ++ A+ ++ A++ L+ V +PG + C WVF Sbjct: 70 QSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVF 107 >AL591024-3|CAH70634.1| 996|Homo sapiens fms-related tyrosine kinase 3 protein. Length = 996 Score = 29.9 bits (64), Expect = 5.2 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 38 KSDYSIKAASVAQLYYGATVVLRSRVRSPGRVKCYWVF 151 +S ++ A+ ++ A++ L+ V +PG + C WVF Sbjct: 70 QSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVF 107 >AL445262-1|CAI17231.1| 996|Homo sapiens fms-related tyrosine kinase 3 protein. Length = 996 Score = 29.9 bits (64), Expect = 5.2 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 38 KSDYSIKAASVAQLYYGATVVLRSRVRSPGRVKCYWVF 151 +S ++ A+ ++ A++ L+ V +PG + C WVF Sbjct: 70 QSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVF 107 >AL356915-1|CAI12447.1| 996|Homo sapiens fms-related tyrosine kinase 3 protein. Length = 996 Score = 29.9 bits (64), Expect = 5.2 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 38 KSDYSIKAASVAQLYYGATVVLRSRVRSPGRVKCYWVF 151 +S ++ A+ ++ A++ L+ V +PG + C WVF Sbjct: 70 QSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVF 107 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,945,911 Number of Sequences: 237096 Number of extensions: 1334641 Number of successful extensions: 2712 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2712 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4593178062 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -