SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0007_N21
         (601 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    23   2.3  
AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.      22   5.3  
AY703618-1|AAU12614.1|  136|Apis mellifera wingless protein.           21   9.2  
AY222546-1|AAP69221.1|  135|Apis mellifera wingless protein.           21   9.2  

>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = -3

Query: 335 LMLKHVKIAPLILTTPRQQ 279
           L LKH++ A L+LT P  +
Sbjct: 64  LNLKHLRAAVLVLTNPSNE 82


>AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.
          Length = 366

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 13/38 (34%), Positives = 17/38 (44%)
 Frame = -1

Query: 283 NSDRNDTVRNVGSPFFTATNQRMRQNNCPSQHTIPLNE 170
           +S +    R  G+ F    NQR+  N    Q T  LNE
Sbjct: 234 SSTKTKMRRKSGATFEEIQNQRVMANVRERQRTQSLNE 271


>AY703618-1|AAU12614.1|  136|Apis mellifera wingless protein.
          Length = 136

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -1

Query: 523 PVPPFCRSSRKL 488
           P PPFC  + KL
Sbjct: 82  PSPPFCEKNPKL 93


>AY222546-1|AAP69221.1|  135|Apis mellifera wingless protein.
          Length = 135

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -1

Query: 523 PVPPFCRSSRKL 488
           P PPFC  + KL
Sbjct: 83  PSPPFCEKNPKL 94


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 156,868
Number of Sequences: 438
Number of extensions: 2941
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17604432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -