Samia BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0007_K08
         (517 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014134-2889|ABI31324.1| 4061|Drosophila melanogaster CG15148-P...    28   8.6  

>AE014134-2889|ABI31324.1| 4061|Drosophila melanogaster CG15148-PC,
            isoform C protein.
          Length = 4061

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 11/37 (29%), Positives = 22/37 (59%)
 Frame = +3

Query: 171  IIGLKHLHSFRRSHLVRN*SIQNEGTFTYQYFNTSSL 281
            I+ + HL    R+HL+R+  +Q  GT + + +  ++L
Sbjct: 2042 IVNMSHLPGINRAHLLRSLLLQLHGTQSLEEYGAATL 2078


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,397,906
Number of Sequences: 53049
Number of extensions: 319588
Number of successful extensions: 470
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 468
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 470
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1887744768
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)