BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I09A02NGRL0007_E24
(571 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB007890-1|BAA24860.3| 1506|Homo sapiens KIAA0430 protein protein. 30 5.0
>AB007890-1|BAA24860.3| 1506|Homo sapiens KIAA0430 protein protein.
Length = 1506
Score = 30.3 bits (65), Expect = 5.0
Identities = 14/62 (22%), Positives = 28/62 (45%)
Frame = +2
Query: 284 YEFSIFYQKLREEAIALFHLFYYAKDFETFYKSAAFARVHLNEGQFLYAYYIAVIQRNDT 463
Y +F EE + L L+ +AK+ + + + ++ L+E Y Y+ + T
Sbjct: 1232 YLVEVFTNDKMEECVKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYTKYVGETLQPKT 1291
Query: 464 HG 469
+G
Sbjct: 1292 YG 1293
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 79,188,841
Number of Sequences: 237096
Number of extensions: 1593037
Number of successful extensions: 3040
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3001
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3040
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 5816287018
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -