Samia BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0006_P22
         (365 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK130364-1|BAC85333.1|  136|Homo sapiens protein ( Homo sapiens ...    30   2.6  

>AK130364-1|BAC85333.1|  136|Homo sapiens protein ( Homo sapiens
           cDNA FLJ26854 fis, clone PRS08062. ).
          Length = 136

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 4/69 (5%)
 Frame = -2

Query: 217 KMICIFLY*ILTMFNHKPRYTRISVNAIFFGTHPSRKAGYYCI----RKETCSLVIEGVY 50
           K +C+    +  ++ +K  ++ I +  +FF   P   A Y+CI    RK   +L      
Sbjct: 27  KKVCLSKLLLSHLWENKALFSLILLKLLFFNESPMEVAAYFCIWQRSRKTKKTLRSRISP 86

Query: 49  KIIKCAAIC 23
           K+  C A+C
Sbjct: 87  KLTCCFALC 95


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 43,424,757
Number of Sequences: 237096
Number of extensions: 732777
Number of successful extensions: 1370
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1347
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1370
length of database: 76,859,062
effective HSP length: 81
effective length of database: 57,654,286
effective search space used: 2306171440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)