Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I09A02NGRL0006_P09
(304 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_UPI000155E878 Cluster: PREDICTED: similar to ribosomal ... 31 6.7
UniRef50_UPI000155BA8E Cluster: PREDICTED: hypothetical protein;... 31 6.7
UniRef50_Q8DHL8 Cluster: Tll1929 protein; n=30; Bacteria|Rep: Tl... 31 6.7
UniRef50_Q4KTH7 Cluster: 60S acidic ribosomal protein P0; n=3; M... 31 6.7
UniRef50_Q5AZ50 Cluster: Putative uncharacterized protein; n=2; ... 31 6.7
UniRef50_P10622 Cluster: 60S acidic ribosomal protein P1-beta; n... 31 6.7
UniRef50_P42038 Cluster: 60S acidic ribosomal protein P2; n=10; ... 31 6.7
UniRef50_P05319 Cluster: 60S acidic ribosomal protein P2-alpha; ... 31 6.7
UniRef50_Q96UQ7 Cluster: 60S acidic ribosomal protein P2; n=3; E... 31 6.7
UniRef50_P99027 Cluster: 60S acidic ribosomal protein P2; n=85; ... 31 6.7
UniRef50_P05387 Cluster: 60S acidic ribosomal protein P2; n=16; ... 31 6.7
UniRef50_O01504 Cluster: 60S acidic ribosomal protein P2; n=3; C... 31 6.7
UniRef50_P05386 Cluster: 60S acidic ribosomal protein P1; n=156;... 31 6.7
UniRef50_P50344 Cluster: 60S acidic ribosomal protein P1; n=14; ... 31 6.7
UniRef50_Q9HFQ7 Cluster: 60S acidic ribosomal protein P1-A; n=11... 31 6.7
UniRef50_Q6AK96 Cluster: Putative uncharacterized protein; n=1; ... 30 8.8
>UniRef50_UPI000155E878 Cluster: PREDICTED: similar to ribosomal
protein P1; n=3; Eutheria|Rep: PREDICTED: similar to
ribosomal protein P1 - Equus caballus
Length = 125
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 114 ESDDDMGFGLFD 125
>UniRef50_UPI000155BA8E Cluster: PREDICTED: hypothetical protein;
n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
hypothetical protein - Ornithorhynchus anatinus
Length = 108
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 97 ESDDDMGFGLFD 108
>UniRef50_Q8DHL8 Cluster: Tll1929 protein; n=30; Bacteria|Rep:
Tll1929 protein - Synechococcus elongatus
(Thermosynechococcus elongatus)
Length = 552
Score = 30.7 bits (66), Expect = 6.7
Identities = 13/36 (36%), Positives = 20/36 (55%)
Frame = -3
Query: 257 WYLLHRNVMFVSRIDRHMGLSVPAVLMRPHVYYDAH 150
W+ R +FVSR+D GL + A ++R Y + H
Sbjct: 324 WWQTERPDLFVSRVDNVTGLDIYAPVLRYETYLNNH 359
>UniRef50_Q4KTH7 Cluster: 60S acidic ribosomal protein P0; n=3;
Metazoa|Rep: 60S acidic ribosomal protein P0 - Suberites
domuncula (Sponge)
Length = 313
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 302 ESDDDMGFGLFD 313
>UniRef50_Q5AZ50 Cluster: Putative uncharacterized protein; n=2;
Trichocomaceae|Rep: Putative uncharacterized protein -
Emericella nidulans (Aspergillus nidulans)
Length = 1607
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 1158 ESDDDMGFGLFD 1169
>UniRef50_P10622 Cluster: 60S acidic ribosomal protein P1-beta;
n=21; Ascomycota|Rep: 60S acidic ribosomal protein
P1-beta - Saccharomyces cerevisiae (Baker's yeast)
Length = 106
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 95 ESDDDMGFGLFD 106
>UniRef50_P42038 Cluster: 60S acidic ribosomal protein P2; n=10;
Eukaryota|Rep: 60S acidic ribosomal protein P2 -
Cladosporium herbarum (Davidiella tassiana)
Length = 111
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 100 ESDDDMGFGLFD 111
>UniRef50_P05319 Cluster: 60S acidic ribosomal protein P2-alpha;
n=19; Eukaryota|Rep: 60S acidic ribosomal protein
P2-alpha - Saccharomyces cerevisiae (Baker's yeast)
Length = 106
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 95 ESDDDMGFGLFD 106
>UniRef50_Q96UQ7 Cluster: 60S acidic ribosomal protein P2; n=3;
Eukaryota|Rep: 60S acidic ribosomal protein P2 -
Rhodotorula glutinis (Yeast)
Length = 110
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 99 ESDDDMGFGLFD 110
>UniRef50_P99027 Cluster: 60S acidic ribosomal protein P2; n=85;
Eukaryota|Rep: 60S acidic ribosomal protein P2 - Mus
musculus (Mouse)
Length = 115
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 104 ESDDDMGFGLFD 115
>UniRef50_P05387 Cluster: 60S acidic ribosomal protein P2; n=16;
Bilateria|Rep: 60S acidic ribosomal protein P2 - Homo
sapiens (Human)
Length = 115
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 104 ESDDDMGFGLFD 115
>UniRef50_O01504 Cluster: 60S acidic ribosomal protein P2; n=3;
Chromadorea|Rep: 60S acidic ribosomal protein P2 -
Caenorhabditis elegans
Length = 107
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 96 ESDDDMGFGLFD 107
>UniRef50_P05386 Cluster: 60S acidic ribosomal protein P1; n=156;
Eukaryota|Rep: 60S acidic ribosomal protein P1 - Homo
sapiens (Human)
Length = 114
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 103 ESDDDMGFGLFD 114
>UniRef50_P50344 Cluster: 60S acidic ribosomal protein P1; n=14;
Dikarya|Rep: 60S acidic ribosomal protein P1 -
Cladosporium herbarum (Davidiella tassiana)
Length = 110
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 99 ESDDDMGFGLFD 110
>UniRef50_Q9HFQ7 Cluster: 60S acidic ribosomal protein P1-A; n=11;
Eukaryota|Rep: 60S acidic ribosomal protein P1-A -
Candida albicans (Yeast)
Length = 106
Score = 30.7 bits (66), Expect = 6.7
Identities = 12/12 (100%), Positives = 12/12 (100%)
Frame = +2
Query: 107 ESDDDMGFGLFD 142
ESDDDMGFGLFD
Sbjct: 95 ESDDDMGFGLFD 106
>UniRef50_Q6AK96 Cluster: Putative uncharacterized protein; n=1;
Desulfotalea psychrophila|Rep: Putative uncharacterized
protein - Desulfotalea psychrophila
Length = 306
Score = 30.3 bits (65), Expect = 8.8
Identities = 13/25 (52%), Positives = 17/25 (68%)
Frame = +1
Query: 166 TCGRINTAGTDKPIWRSMRLTNITF 240
TC + AG+DK IW + RLT+ TF
Sbjct: 39 TCLKRQKAGSDKKIWNTDRLTDDTF 63
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 204,184,667
Number of Sequences: 1657284
Number of extensions: 2925299
Number of successful extensions: 6724
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 6652
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6724
length of database: 575,637,011
effective HSP length: 77
effective length of database: 448,026,143
effective search space used: 10304601289
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -