SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0005_O03
         (560 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    27   0.13 
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    22   3.7  
AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamat...    21   8.5  
AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamat...    21   8.5  

>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 27.1 bits (57), Expect = 0.13
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = +3

Query: 390 FNANTKKWAKQKDNENKRSFCMYVLDPIYKVFDAIMNFKKEEIDSL 527
           FN N  K  + KD  NK+   +   + +YK+ D   N KKE  D L
Sbjct: 537 FNVNATK--QIKDEANKKGVSLRFYNVVYKLID---NIKKEIYDIL 577


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = +2

Query: 8   SSCCGGLCLWCVRTNRDRAASGNRRAHQA 94
           ++  GGLC    R N    +SG+   H+A
Sbjct: 529 ATLAGGLCPHRRRANSGSTSSGDDELHRA 557


>AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamate
           receptor 1 protein.
          Length = 843

 Score = 21.0 bits (42), Expect = 8.5
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 25  TVSLVCAYKPR 57
           TV+LVC Y P+
Sbjct: 749 TVTLVCLYSPK 759


>AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 933

 Score = 21.0 bits (42), Expect = 8.5
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 25  TVSLVCAYKPR 57
           TV+LVC Y P+
Sbjct: 839 TVTLVCLYSPK 849


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 144,177
Number of Sequences: 438
Number of extensions: 2764
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 16195212
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -