Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0005_M02
         (600 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U09586-3|AAC47272.1|  470|Tribolium castaneum integrase protein.       24   1.1  
EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    22   3.4  

>U09586-3|AAC47272.1|  470|Tribolium castaneum integrase protein.
          Length = 470

 Score = 23.8 bits (49), Expect = 1.1
 Identities = 9/34 (26%), Positives = 18/34 (52%)
 Frame = +1

Query: 277 ILGWHHQLCGILLRTNRHYKMSNLYRWRDVRKSL 378
           ++ +HHQL G    T  +  M   Y W ++ +++
Sbjct: 132 LVDYHHQLLGHFGATKVYNSMKREYYWPNMYRTI 165


>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 5/12 (41%), Positives = 9/12 (75%)
 Frame = +2

Query: 161 CTFEILWPRPIH 196
           C+   +WP+P+H
Sbjct: 72  CSEPAIWPKPVH 83


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 140,155
Number of Sequences: 336
Number of extensions: 3100
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15143945
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)