SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0005_I20
         (581 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    23   1.7  
DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex det...    23   2.9  
DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex det...    23   2.9  
DQ325122-1|ABD14136.1|  179|Apis mellifera complementary sex det...    23   2.9  
DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex det...    23   2.9  
DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex det...    23   2.9  
DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex det...    23   2.9  
DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex det...    23   2.9  
DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex det...    23   2.9  
DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex det...    23   2.9  
DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex det...    23   2.9  
DQ325105-1|ABD14119.1|  180|Apis mellifera complementary sex det...    23   2.9  
DQ325104-1|ABD14118.1|  180|Apis mellifera complementary sex det...    23   2.9  
DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex det...    23   2.9  
DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex det...    23   2.9  
DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex det...    23   2.9  
DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex det...    23   2.9  
DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    23   2.9  
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    23   2.9  
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    23   2.9  
DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex det...    23   2.9  
DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex det...    23   2.9  
DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex det...    23   2.9  
DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex det...    23   2.9  
DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex det...    23   2.9  
DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex det...    23   2.9  
AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    23   2.9  
AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex det...    23   2.9  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    23   2.9  
AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex det...    23   2.9  
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    23   2.9  
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    23   2.9  
AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex det...    23   2.9  
AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex det...    23   2.9  
AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex det...    23   2.9  
AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex det...    23   2.9  
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    23   2.9  
AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    22   5.1  
AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.     22   5.1  
DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    21   6.7  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    21   6.7  
AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    21   6.7  
DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.           21   8.9  
DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein p...    21   8.9  
AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic ac...    21   8.9  
AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly pro...    21   8.9  

>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 23.4 bits (48), Expect = 1.7
 Identities = 9/28 (32%), Positives = 16/28 (57%)
 Frame = -3

Query: 366  RDEQRDPSRGAEAPALEVMTPRLHTPGD 283
            ++  R+  RG E+    V+  R+H PG+
Sbjct: 1175 QEMMREAGRGIESAKSYVVDVRVHVPGE 1202


>DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 147 RYIGPPTPFP 156


>DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 147 RYIGPPTPFP 156


>DQ325122-1|ABD14136.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 147 RYIGPPTPFP 156


>DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 149 RYIGPPTPFP 158


>DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 149 RYIGPPTPFP 158


>DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 149 RYIGPPTPFP 158


>DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 149 RYIGPPTPFP 158


>DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 149 RYIGPPTPFP 158


>DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 153 RYIGPPTPFP 162


>DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 149 RYIGPPTPFP 158


>DQ325105-1|ABD14119.1|  180|Apis mellifera complementary sex
           determiner protein.
          Length = 180

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 148 RYIGPPTPFP 157


>DQ325104-1|ABD14118.1|  180|Apis mellifera complementary sex
           determiner protein.
          Length = 180

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 148 RYIGPPTPFP 157


>DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 143 RYIGPPTPFP 152


>DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 143 RYIGPPTPFP 152


>DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 143 RYIGPPTPFP 152


>DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 143 RYIGPPTPFP 152


>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 154 RYIGPPTPFP 163


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 154 RYIGPPTPFP 163


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 157 RYIGPPTPFP 166


>DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 147 RYIGPPTPFP 156


>DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 152 RYIGPPTPFP 161


>DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 152 RYIGPPTPFP 161


>DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 152 RYIGPPTPFP 161


>DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 149 RYIGPPTPFP 158


>DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex
           determiner protein.
          Length = 191

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 159 RYIGPPTPFP 168


>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 368 RYIGPPTPFP 377


>AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 374 RYIGPPTPFP 383


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 394 RYIGPPTPFP 403


>AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 364 RYIGPPTPFP 373


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 375 RYIGPPTPFP 384


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 375 RYIGPPTPFP 384


>AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 364 RYIGPPTPFP 373


>AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex
           determiner protein.
          Length = 413

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 382 RYIGPPTPFP 391


>AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 368 RYIGPPTPFP 377


>AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex
           determiner protein.
          Length = 418

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 386 RYIGPPTPFP 395


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 148 RYEGPPTPCP 177
           RY GPPTP P
Sbjct: 396 RYIGPPTPFP 405


>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 5/17 (29%), Positives = 13/17 (76%)
 Frame = -2

Query: 175 DMASADLHISDAVDAVD 125
           DM+  ++H+SD ++ ++
Sbjct: 6   DMSDGNIHMSDVIEVIE 22


>AY268030-1|AAP23055.1|  602|Apis mellifera dorsal protein protein.
          Length = 602

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 5/17 (29%), Positives = 13/17 (76%)
 Frame = -2

Query: 175 DMASADLHISDAVDAVD 125
           DM+  ++H+SD ++ ++
Sbjct: 6   DMSDGNIHMSDVIEVIE 22


>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 10/33 (30%), Positives = 16/33 (48%)
 Frame = +2

Query: 437 DTRTPPARTSPSAAMDTTSWDVSRVKAEMFRIK 535
           + + PP+ T  S +MD  S  V    +  F +K
Sbjct: 339 EKKYPPSETEQSTSMDLPSDQVEPDNSSNFAMK 371


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 10/33 (30%), Positives = 16/33 (48%)
 Frame = +2

Query: 437 DTRTPPARTSPSAAMDTTSWDVSRVKAEMFRIK 535
           + + PP+ T  S +MD  S  V    +  F +K
Sbjct: 339 EKKYPPSETEQSTSMDLPSDQVEPDNSSNFAMK 371


>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 10/37 (27%), Positives = 16/37 (43%)
 Frame = +2

Query: 320 RAGASAPRDGSRCSSRSCTIPHSNITHRVSISRTQRR 430
           R  +S P D         TI H+N   R+  +R  ++
Sbjct: 275 RTASSTPEDLQDLEEPLTTIQHNNCLTRIPSTRINKQ 311


>DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.
          Length = 552

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -3

Query: 171 WRRRTFISLMRW 136
           WR + FI+L +W
Sbjct: 195 WRDKVFITLPKW 206


>DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein
           protein.
          Length = 430

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 5/12 (41%), Positives = 9/12 (75%)
 Frame = -3

Query: 171 WRRRTFISLMRW 136
           WR + F+++ RW
Sbjct: 75  WRNKLFVTVPRW 86


>AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha-3 protein.
          Length = 537

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 7/16 (43%), Positives = 12/16 (75%)
 Frame = +2

Query: 371 CTIPHSNITHRVSISR 418
           CT P+S+IT  +++ R
Sbjct: 232 CTEPYSDITFNITMRR 247


>AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly
           protein MRJP2 protein.
          Length = 452

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 5/12 (41%), Positives = 11/12 (91%)
 Frame = -3

Query: 171 WRRRTFISLMRW 136
           WR +TF++++R+
Sbjct: 73  WRDKTFVTILRY 84


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 166,332
Number of Sequences: 438
Number of extensions: 3096
Number of successful extensions: 52
Number of sequences better than 10.0: 46
Number of HSP's better than 10.0 without gapping: 52
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16870914
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -